javcensored lingerie high visio creampie censored




FC2NACXHDKAKBIADNAVSANATRVEMAAWDDTTSTARSSQTEMIDEMVSDNNPJHODVCESDJUFENACRMIAACJOD

2020-09-25
121 min

[GNAX-036]A Big Tits Who Was Made To Cum Over And Over And Lost Her Mind When Her Husband Went Away On A Business Trip Yurika Aoi

  • yurika censoredcreampiebig titsGNAXnagiraGNAX-036GNAX036h-1345gnax00036
    • 2020-09-29
    36 min

    416SVMM-032 Chiharuchan

  • amateur censoredsquirtingamateursvmmsvmm-032svmm032416svmm-032
    • 2020-10-01
    120 min

    [EMOT-012]Enjoy Newlywed Life With Rika Tsubaki In Complete POV

  • tsubaki rika censoredcreampiebig titsEMOTplanet plusdirector oemotionEMOT-012EMOT012h-237emot00012
    • 2020-10-01
    70 min

    [ZOZO-019]Shame! A Young Boys And Girls Mixed Naked Bodies Strength Test 2020 4 Ab Strength Tests - A Battle-Style Pussy Pressure Test - Female Reproductive Strength Tests 2

  • censoredZOZOsadistic villageZOZO-019ZOZO0191zozo00019
    • 2020-10-02
    35 min

    [BTH-074]I Want To Shower This Woman With Cum Face Semen Splatters Aimi Yoshikawa

  • yoshikawa aimi censoredbig titssingle workBTHchobitchchovicBTH-074BTH074h-1435bth00074
    • 2020-10-21
    67 min

    FC2PPV 1541759 [Kagawa Prefecture, Shikoku] Gonzo of local idols in the countryside leaked out to the world. Click here for the pattern of the young lady’s dangerous and cool play. ≪No.74≫

  • amateur uncensoredfc2
    • 2020-11-03
    70 min

    1Pondo 110320_001 Yukari Sato

  • amateur uncensored1pondo
    • 2020-11-14
    251 min

    [LHTD-011]Take On The Challenge! The Big Vibrator Timer Shizuku Momoka Akane

  • asahi dro yoshino momoka censoredLHTDocean bookslight houseLHTD-011LHTD011171lhtd00011
    • 2020-11-20
    72 min

    [HYPN-034]My Exclusive Slut: Hard-Headed Female Spy Brainwashed And Seduced Repeatedly Iori Kogawa

  • iori furukawa censoredblowjobHYPNsod createsatoshi morikawamind controlHYPN-034HYPN0341hypn00034
    • 2020-11-24
    60 min

    1Pondo 112420_001 Braless Neighbor In The Morning: Airi Mikumo

  • amateur uncensored1pondo
    • 2020-12-06
    114 min

    [PKPD-122](Filmed Without Permission) Amateur Barely Legal Three-Way - Compensation Dating With My Classmate

  • censoredcreampieschoolgirlPKPDfuck group and fun friends daydreamersPKPD-122PKPD122pkpd00122
    • 2020-12-11
    44 min

    FC2PPV 1598669 [No x Creampie] Sex with that beautiful model at the inn! [Part 2]

  • amateur uncensoredfc2
    • 2020-12-17
    120 min

    [JRZE-014]First Time Filming My Affair Yuko Matsuda

  • yuko matsuda censoredcreampiemature womanJRZEcenter villagekotaro misatojurakuJRZE-014JRZE014h-086jrze00014
    • 2020-12-20
    116 min

    [HND-929]She Stole One Condom From Her Stepbrother To Fuck Her Boyfriend But They Wore It Out After Just One Load, So She Had Her First Ever Creampie. Mahiro Ichiki

  • mahiro ichiki censoredcreampieuniformHNDhon nakahiroaHND-929HND929hnd00929
    • 2020-12-25
    174 min

    [GYAN-010]Her Pussy Is Prematurely Cumming An Overwhelming 39 Times! We're Using A Remote-Controlled Vibrator To Get Her Exhibitionist Pussy Unstoppably Wet And As She Crouches Down In Shame, She Continues To Cum She Was In A Trance Of Orgasmic P

  • akari shinmura censoredsingle workGYANprestigehimu lockgyan prestigeGYAN-010GYAN010118gyan00010
    • 2021-01-01
    120 min

    [NACR-380]A Silly Wife In The Neighborhood - Honoka Tsuji

  • tsujii honoka censoredcreampiebig titsNACRplanet plusdirector oshichidomeNACR-380NACR380h-237nacr00380
    • 2021-01-24
    63 min

    299EWDX-345 The F cup 145cm mini loose fluffy wife was a carnivorous wife who pleaded for a kiss from herself!

  • amateur censoredmarried womansquirtingewdxewdx-345ewdx345299ewdx-345
    • 2021-01-29
    39 min

    FC2PPV 1664540 Until 1st 1980pt → 1580pt [Personal shooting] Slender married woman nurse with thick stranger stick and 3P continuous vaginal cum shot. Let me massage oil and squirt M man.

  • amateur uncensoredfc2
    • 2021-02-12
    67 min

    [ZOZO-038]Miss Miyuki Arisaka

  • censoredcreampieZOZOsadie willenauZOZO-038ZOZO0381zozo00038
    • 2021-02-12
    240 min

    [SOUD-029]BEST Of Slutty White Gal Fucks

  • censoredamateurbeautiful girlSOUDprestigestrongest chome chomeSOUD-029SOUD029118soud00029
    • 2021-02-22
    115 min

    [PRBYB-071]Instinctive Nude H[

  • censoredbig titsbeautiful girlPRBYBintec incPRBYB-071PRBYB071h-706prbyb00071
    • 2021-03-06
    156 min

    [BBAN-317]First Love: Lesbian Lovers Lose Track Of Time And Space Fucking - Saeko Hiiragi, Urara Uraraka

  • hiiragi saeko beautiful censoredlesbianBBANbibianBBAN-317BBAN317bban00317
    • 2021-03-16
    135 min

    [SDNM-270]Real Married Women Appear Together In Their Label Debut! Three Married Women Who Came To The Hot Spring With Their Husbands Seduced Me And Became My Harem! Reverse 4P

  • soma shiori hirai censoredcreampiemature womanSDNMsod createzaku araigenuine married woman the porn experienSDNM-270SDNM2701sdnm00270
    • 2021-03-17
    47 min

    492MERC-285 Ro-Kon bastard aiming for prey in the park 2

  • amateur censoredcreampieamateurmercmerc-285merc285492merc-285
    • 2021-03-18
    86 min

    [THNIB-070]The Cutest Girl In Class/Sakura Hyakuno

  • censoredbig titsbeautiful girlTHNIBintec incTHNIB-070THNIB070h-706thnib00070
    • 2021-04-16
    60 min

    230OREC-744 Hinako

  • amateur censoredcreampieamateurorecorec-744orec744230orec-744
    • 2021-05-02
    44 min

    188HINT-0456 Yukari

  • amateur censoredcreampiemarried womanhinthint-0456hint0456188hint-0456
    • 2021-05-06
    121 min

    [AKDL-106](Hands And Feet Bondage Threesome) Raunchy Masochistic Nympho Wants To Be Ravished Thick White Cum Creampie SEX

  • shizuka sugisaki shiraishi plane censoredcreampiebeautiful girlAKDLaquinoristickaknrAKDL-106AKDL1061akdl00106
    • 2021-05-18
    45 min

    396BIG-100 Hono

  • amateur censoredcreampieamateurbigbig-100big100396big-100
    • 2021-05-21
    117 min

    [CAWD-223]Her Slut Scores Are Off The Charts! Meru Ito - This Half-Japanese Beautiful Girl From Taiwan Is Finally Ready For A Creampie! Cowgirl Angel Humping Her Hips For Raw Cum Pleasure

  • ito meru censoredcreampiesquirtingCAWDkawaiiinaballCAWD-223CAWD223cawd00223
    • 2021-06-10
    240 min

    [SW-779]I Went To A Coed Hot Spring Resort Filled With Nothing But Women, And I Was The Only Man There 15 Big Tits Mamas A 240-Minute Special Faced With All These Huge Tits, My Adolescent Cock Was Rock Hard And Ready To Roll, So I Squeezed It Hard, P

  • censoredbig titsmarried womanSWswitchyocchanswitch switchSW-779SW7791sw00779
    • 2021-06-17
    69 min

    200GANA-2506 Seriously Nampa, first shot. 1649 Pretending to be a neat music college student who aspires to be a music teacher and picking up! Although I am confused by the erotic story, if I give a flickering reward, I will be swept away and open my

  • amateur censoredbig titsamateurganagana-2506gana2506200gana-2506
    • 2021-06-24
    118 min

    [MILK-112]I Love Older Men I'll Cover You In Sloppy Wet Kisses Coed Slut Mao Watanabe

  • mao watanabe censoreduniformschoolgirlMILKmilkMILK-112MILK112h-1240milk00112
    • 2021-06-26
    47 min

    C0930 ki210627 Kayoko Yuge 31years old

  • amateur uncensoredc0930
    • 2021-07-17
    168 min

    [CJOD-306]"Wanna Come To My Room？" My Neighbors Are Stacked Wives Who Wear Skintight Dresses, Starring Hikari Kisaki And Kyoko Maki

  • hikari hime maki kyoko censoredcreampiebig titsCJODchijo heavenmametaro mamezawaCJOD-306CJOD306cjod00306
    • 2021-07-17
    116 min

    [HMN-016]This Tall Former Ace Female Volleyball Player With Voluptuous Thighs And A Big Ass Was A Regular At National Tournaments, But Here She Is Now, Having Her First Raw Creampie Fuck Shiori Kimura

  • shiori kimura censoredcreampiesingle workHMNhon nakahiroaHMN-016HMN016hmn00016
    • 2021-07-20
    103 min

    FC2PPV 1899066 [Personal Shooting] Cool And Pretty Wet Beautiful Girl Seira-Chan Subjective / Objective Set

  • amateur uncensoredfc2
    • 2021-08-20
    93 min

    277DCV-188 Is It Okay To Send It Home？ Case.182 Pillage! Ntr! The Villainous Fucking Bitch Who Always Drops The Target Man! [Magic Belochu Barrage Sp] ⇒ Vaginal Kiss In French Literature! Erotic Deviation Value Exceeds 70 ⇒ 300 People Slash On The Sa

  • amateur censoredamateurdcvdcv-188dcv188277dcv-188
    • 2021-08-20
    137 min

    [ROE-005]It"s Like She"s On Another Level. The Epitome Of Beautiful MILFs / Momoko Isshiki Makes A Shocking Transfer To Monroe!! In The Office Or Working From Home, During Online Meetings, My Female Boss Continues To Seduce Me.

  • momoko isshiki censoredmature womanslutROEmadonnakoyama masatsugumonroeROE-005ROE005roe00005
    • 2021-08-30
    51 min

    292MY-465 Kaneko hitona 1

  • amateur censoredbig titsmarried womanmymy-465my465292my-465
    • 2021-09-09
    80 min

    168HRS-012 Chitose 2

  • amateur censoredcreampiebig titshrshrs-012hrs012168hrs-012
    • 2021-09-10
    45 min

    FC2PPV 2185081 [Individual Shooting] The Best! A Large Amount Of Vaginal Cum Shot That Miraculously Meets A Beautiful Big Tits Geki Kawa J System And Is Conceived By An Inspiring Raw Paco

  • amateur uncensoredfc2
    • 2021-09-20
    88 min

    [YOZ-388]From Tokyo! Mature Woman Lingerie Special Prostitution, Raw Sex Negotiation

  • misa kyono satomi someya censoredmature womanlingerieYOZstar paradiseyoru ouzokuYOZ-388YOZ388h-254yoz00388
    • 2021-10-28
    125 min

    [SPRD-1473]This World Is Made Of Men And Women, And Nothing Else An Old Man Who Likes To Lick, And A Horny Bride June Lovejoy

  • june lovejoy censoredmature womansingle workSPRDtakara eizoukuromatsu shigealeddinSPRD-1473SPRD147318sprd01473
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-10-30
    160 min

    [LULU-102]Wife With Beautiful Tits Gets A Sexy Oil Treatment From Former Masseuse Father-In-Law, He Teases Her Sticky Erogenous Zone, Cuckholded By Wet Smothering Kisses After She Could Not Bear The Pleasure... Riria Hyodo

  • riria hido censoredsingle workLULUlunaticsvragmanLULU-102LULU102lulu00102
    • 2021-11-25
    127 min

    [IESM-063]Mikako Horiuchi. S&M. S&M Ban Lifted. Breaking In with Candles, Hard Whip Play.

  • mikako horiuchi censoredcreampiebdsmIESMienergykikuriniesmIESM-063IESM0631iesm00063
    • 2021-12-04
    51 min

    10musume 120421_01 An Amateur Girl With Outstanding G Cup Style Licks The Whole Body Of An Old Man Yu Nagata

  • amateur uncensored10musume
    • 2021-12-09
    183 min

    [NHDTB-607]Massage Clinic Where A Vigorous Older Guy Gives A S********l Magic Chems So He Can Suck Her Sensitive Big Tits And Fuck Her Non-stop.

  • censoredbig titsschoolgirlNHDTBnatural highvanilla sakuraiNHDTB-607NHDTB6071nhdtb00607
    • 2021-12-11
    128 min

    [DBER-134]Bizarre Sexual Acrobatics Shinobu: Kunoichi"s Crying Anal Stretching Execution Episode-3 Reo Asuka"s Bombing And Sinking.

  • otsu alice censoredanalbdsmDBERbabyentertainmentkikubonred babeDBER-134DBER134dber00134
    • 2021-12-24
    152 min

    [SSIS-273]3 Days With Girlfriend Out of Town. First Time For Sex In A Month Simultaneously With C***dhood Pal (Sex Friend) And Babysitter. Yura Kano

  • yura kanno censoredbeautiful girlsingle workSSISs1 no 1 styleamazing meatSSIS-273SSIS273ssis00273
    • 2021-12-24
    154 min

    [AKID-090]Sexually Frustrated Girls That Only Want To Fuck. Voyeur In-room Camera - Keeping It Quiet And Doing AV No.49 - Misaki, H-cup, Age 26, Slutty Hair Dresser That Just Wants To Fuck. Hiroko, F-cup, Age 28, School Teacher That"s A Slut In P

  • censoredslutAKIDomochikaeri mousozokumanji groupAKID-090AKID090akid00090
    • 2022-01-01
    137 min

    [PKPD-177]Is There Anyone Here Who Loves Cock And Wants To Try Getting Fucked Raw？ Devilish S********l Who Loves Creampies Aya Izumi

  • aya izumi censoredcreampiebeautiful girlPKPDpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPD-177PKPD177pkpd00177
    • 2022-01-05
    86 min

    SMUK-083 Miina (Miina Konno)

  • amateur censoredcreampieuniformsmuksmuk-083smuk083smuk-083
    • 2022-01-08
    133 min

    [DVAJ-553]I"m Almost Positive That My Wife Is Committing Infidelity, But She Isn"t Letting It Slip, And It"s Driving Me Insane In This Newly Wed Lifestyle Riho Fujimori

  • riho fujimori censoredcreampiebig titsDVAJalice japankirinDVAJ-553DVAJ553dvaj00553
    • 2022-01-14
    66 min

    SIRO-4643 [First Shot] [Erotic Face X Erotic Voice] [Indecent Tongue] An H Cook Who Gets Drunk With The Sweet Stimulus After A Long Absence While Saying That It Is For The Cost Of Going On A Trip. She Shakes A Well-Shaped F Milk Every Time She Is Vio

  • amateur censoredbig titsamateursirosiro-4643siro4643siro-4643



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi