javcensored older sister multiple episodes high vision jav




FC2MIDVAUKSBLKCAWDHDKASTARSVEMAMILKHNDSQTENACXAPODVENUAUKGNATRAMBIHUNTBDTTMARACJOD

2021-06-12
126 min

[HOKS-096]Forbidden Step Family Love Step Father / Older Step Brother / Younger Step Brother / Lecherous Old Man

  • miu susaki nagase mana censoredbig titsdramaHOKSfa prokinzo ogurokkuHOKS-096HOKS096hoks00096
    • 2020-11-13
    116 min

    [VRTM-520]"I'm Not Gonna Let You Cum!" - A Private Tutor In Knee Socks Does Cum Control On Her Cherry Boy S*****t! - She Makes Him Save It Up Until He's Ready To Explode, Then Finally Lets Him Cum Inside Her! 2

  • aishin shinkawa kurata mao censoredslutVRTMv r producegoro koenjiVRTM-520VRTM520h-910vrtm00520
    • 2020-09-11
    122 min

    [VRTM-519]My 2 Females Bosses In Black Pantyhose Both Missed The Last Train And Came Back To My Place! - They're In The Mood For Cock And Let Me Fuck Them Until Morning! 2

  • kurata mao aishin shinkawa censoredcreampiebig titsVRTMv r produceeigo mochizukiVRTM-519VRTM519h-910vrtm00519
    • 2020-08-14
    113 min

    [VRTM-510]This Repressed Huge Tits Private Tutor Teased Me Over And Over With Pull Out Sex Behind My Parents' Backs

  • sachiko ena koume censoredcreampiebig titsVRTMv r producegoro koenjiVRTM-510VRTM510h-910vrtm00510
    • 2020-07-25
    122 min

    [AUKG-492]Lesbian Peeping - I Lured That Cold Fish Bitch To My Room And Secretly Filmed Her -

  • censoredlesbianAUKGu kAUKG-492AUKG492aukg00492
    • 2020-07-10
    123 min

    [VRTM-513]We Gave Aphrodisiacs And S******g Pills To A Cabin Attendant With A Big Ass In Black Pantyhose! Then We Tied Her Up While She Was S******g And A*****ted Her With A Vibrator! Once She's Fully Aroused, She Gets Fucked Hard Until Her Knees

  • hasumi claire akari shinmura censoredbig titsVRTMv r produceeigo mochizukiVRTM-513VRTM513h-910vrtm00513
    • 2020-07-03
    115 min

    [PARATHD-2938]10 Huge Tits Elder Sister Babes! Jiggling And Wiggling Titties In V*****t Orgasms And Rough Sex Deluxe Edition (2)

  • censoredbig titsPARATHDparadise tvPARATHD-2938PARATHD2938parathd02938
    • 2020-04-10
    120 min

    [VRTM-494]"It's Been A Long Time Hasn't It..." Hiding Under The Bed Covers With That C***dhood Friend You Used To Flirt With - Hot And Sweaty SEX Licking Each Other All Over, Holding Each Other Tight While Fucking And Giving Her A Cre

  • mitani akari hasumi claire censoredcreampieVRTMv r producegoro koenjiVRTM-494VRTM494h-910vrtm00494
    • 2020-03-13
    120 min

    [VRTM-488]"I'm Not Gonna Let You Cum!" - A Private Tutor In Knee Socks Does Cum Control On Her Cherry Boy S*****t! - She Makes Him Save It Up Until He's Ready To Explode, Then Finally Lets Him Cum Inside Her!

  • manami oura miho tsuno censoredslutVRTMv r producegoro koenjiVRTM-488VRTM488h-910vrtm00488
    • 2020-02-09
    118 min

    [AUKG-481]Morning Visit Lesbian Sex - This Girl Is Getting Lesbian Bombed In The Early Morning During Non-REM Sleep! -

  • toua kotone shiraito rin censoredlesbianAUKGu krentoAUKG-481AUKG481aukg00481
    • 2019-12-13
    119 min

    [VRTM-471]This Kind And Gentle Big Ass Big Stepsister Was Wearing A Tight Skirt And Exerted Her Total Domain Over A Horny Little Stepbrother! When She Was Given Aphrodisiacs, She Started To Rub Her Knee-High Socks Against Him And Dripped Juicy Stains

  • nanako miyamura ririka censoredcreampiesisterVRTMv r producegoro koenjiVRTM-471VRTM471h-910vrtm00471
    • 2019-11-24
    117 min

    [AUKG-472]HIP HIP LESBIAN

  • sumire kurokawa blue censoredlesbianAUKGu krentoAUKG-472AUKG472aukg00472
    • 2019-09-13
    121 min

    [VRTM-453]This Little Brother-In-Law Is Lusting For His Kind And Gentle Big Ass Big Sister-In-Law Who Wears A Tight Skirt! When He Gave Her Aphrodisiacs To Drink She Started Rubbing Her Knee-High Socks Up Against Him And Staining Her Panties, And The

  • otsuki sound yuki sakuragi censoredcreampiesisterVRTMv r producerokutanzo no seishiVRTM-453VRTM453h-910vrtm00453
    • 2019-08-23
    105 min

    [XRW-739]A Voluptuous Elder Sister In A Competitive Swimsuit Gets Her Thighs Assaulted By A Maso Man

  • himari ogawa yukina midwinter censoredXRWreal worksreal real worksXRW-739XRW739172xrw00739
    • 2018-10-19
    249 min

    [DOCP-099]Her Voluptuous Ass Is Tightly Stuck To My Cock!! Every Time She Teasingly Shakes Her Ass, She Can Feel My Cock Get Bigger, And Then She Began To Lure Me To Temptation With Some Sexy Rump Shaking...

  • misaka ria nanami yua censoredslutDOCPprestigedoc premiumDOCP-099DOCP099118docp00099
    • 2017-06-02
    127 min

    [GNE-179]My Girlfriend's Excessively Beautiful Older Sister Lured Me To Temptation 2

  • nozomi kitano rui hasegawa censoredslutGNEgallopGNE-179GNE179h-479gne00179



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi