julia




FC2RBDGMEMHDKAJUFEAVSABLKSANPPPDAMBICJODMVSDMILKATIDNACRFSDSSWAAASSISMIDVVENUMIDE

2020-09-22
57 min

SIRO-4243 [First shot] [Bewitching Yamato Nadeshiko] [Erotic body drawn in] The 19-year-old glossy face at the moment of inserting a meat stick is too erotic. Beautiful black-haired Yamato Nadeshiko panting in a nasty appearance .. AV application on

  • amateur censoredbig titssquirtingsirosiro-4243siro4243siro-4243
    • 2020-10-08
    193 min

    [DANDY-733]I Got Turned Into A Sex Toy Between Two Of My Mom Friends' Big Tits At A Mixed Bathing Hot Spring Resort vol. 2

  • yoshine yuria arisa hanyu arisu hanyu censoredbig titsslutDANDYdandymagical kikutasoDANDY-733DANDY7331dandy00733
    • 2020-10-09
    131 min

    [KBI-045]Naughty Nymphos - No-Good Girl Seduces Her Best Friend's Husband And Takes His Creampie Honoka Yonekura

  • hoika yonekura censoredbig titsmature womanKBIprestigetsuruhashikanbiKBI-045KBI045118kbi00045
    • 2020-11-13
    200 min

    [MDBK-142]Submissive Private Tutor With Big Tits Can't Say No To Her S*****t Asking For Sex After Getting 100 On His Test, Gets Creampie

  • nene tanaka yuri fukada censoredcreampiebig titsMDBKbazookashizukamanMDBK-142MDBK142h-1496mdbk00142
    • 2020-11-19
    120 min

    [TPPN-179]Her Sensitive Body Cums Hard - Wails Of Pleasure As Ecstasy Runs Through Her Whole Body Rika Aimi

  • rumi tadami censoredbig titsbeautiful girlTPPNteppanTPPN-179TPPN179tppn00179
    • 2020-11-20
    48 min

    [EMOI-031][Part One] Cheater's Heart - The Story Of The Sexiest Thing That Happened To Me In My Whole Life - Her School Years - Mao Watanabe

  • mao watanabe censoreddramaEMOIsod createinugami ryoemo girlEMOI-031EMOI0311emoi00031
    • 2020-11-28
    118 min

    [MIMK-078]This Book Is All About Getting Some Trim From A Girl At A 1,000 Yen Barber Shop. Live Action Adaptation Based On The Book By: Hayo Cinema This Flesh Fantasy Comic Is 120 Full Of Maximum Eroticism, Has Sold A Total Of Over 60,000 Copies, And

  • censoredcreampiebig titsMIMKmoodyzdragon nishikawamankitsuMIMK-078MIMK078mimk00078
    • 2020-12-01
    125 min

    [HDKA-222]Bare Naked Ballet Teacher Kanoko Higuchi

  • kanoko higuchi censoredcreampiebig titsHDKAplanet plusdirector onudityHDKA-222HDKA222h-237hdka00222
    • 2020-12-05
    114 min

    [ADN-279]Dirty Licker Desires Of A Father-In-Law 6 Minori Hatsune

  • hatsune minori censoredbig titssingle workADNattackersnaotootona no dramaADN-279ADN279adn00279
    • 2020-12-08
    115 min

    [ARM-931]Guys Blow Their Loads From Face-Sitting In Panties And Being Smothered By Tits While Their Nipples Are Teased - Their Cocks Aren't Touched At All

  • yurika mine yuri sasahara censoredbig titsARMaroma planninghamu oujiaromaARM-931ARM931arm00931
    • 2020-12-09
    43 min

    FC2PPV 1600306 Nasty secret meeting with a receptionist of a famous company during the self-restraint period ❤️❤️ Because it was so comfortable … I made a vaginal cum shot without permission!

  • amateur uncensoredfc2
    • 2020-12-12
    119 min

    [MEYD-637]Today, Cum Inside Me Till I'm Pregnant... Yumi Kazama

  • kazama yumi censoredcreampiebig titsMEYDtameike gorodai omuraMEYD-637MEYD637meyd00637
    • 2020-12-18
    115 min

    [PARATHD-3054]My Friend's Mom Is A Braless Cleaning Lady Highlights Collection (2) - One Touch Of Her Sexy Big Tits Is Enough To Bust Your Nut!

  • censoredbig titsmilfPARATHDparadise tvPARATHD-3054PARATHD3054parathd03054
    • 2020-12-21
    134 min

    [AGAV-042]Nympho Sisters - It's Only Natural That You Share Your Fuck Buddy! These Sisters Love Big Hard Cocks And They Love To Hit You With Dirty Talk And Harlem Slut Plays! -

  • misaki azusa akari shinmura censoredbig titsslutAGAVsex agent daydreamersdaibutsu yoshidasex agentAGAV-042AGAV042agav00042
    • 2020-12-25
    106 min

    [YSN-535]My Stepdaughter Came Home For A Family Visit, And She Discovered My Sex Toys, But Instead Of Showing Contempt For My Lonely Ass, She Expressed Kindness And Tenderness Towards Me, And That Part Was All Good, But Then She Gave My Cock Some Soo

  • mitsuha higuchi yuki hiraoka censoredblowjobYSNnonYSN-535YSN535h-127ysn00535
    • 2021-01-04
    120 min

    [C-2604]Raw Footage Lesbian Series Hot Springs Trip 12

  • censoredCgogosgogo s coreC-2604C2604140c02604
    • 2021-01-08
    93 min

    [OKS-103]Wet And Shiny And Tight A Goddess In A Competitive Swimsuit Lala Momota Enjoy A Cute Girl In A School Swimsuit To Your Heart's Content! Watch Her Change In Peeping Videos, And Check Out Her Tiny Titties, Big Tits, And Shaved Pussy Fun, T

  • also brought censoredbeautiful girlsingle workOKSdaddy s private photosgoddess in a school swimsuitOKS-103OKS1031oks00103
    • 2021-01-13
    37 min

    230ORE-741 Y sensei

  • amateur censoredcreampiebig titsoreore-741ore741ore-741
    • 2021-01-30
    61 min

    HEYZO 2457 Orgasms With A Horny Pussy Girl Vol.12 – Non Suzumiya

  • non suzumiya uncensoredcreampiehandjobheyzo
    • 2021-02-12
    40 min

    417SRYA-010 I was targeted by a slime milk crocodile! !! There is a woman’s predecessor in the open-air bath … The cock begins to react to the naked woman’s body, straddling the awkward me, and the semen tank is empty due to the angry

  • amateur censoredcreampiebig titssryasrya-010srya010417srya-010
    • 2021-02-18
    53 min

    [GRMR-034]スローセックスに溶かされて

  • mihina azumihina mihina nagai hiroomi nagase censoredGRMRmura chleo hakusanGRMR-034GRMR034h-1534grmr00034
    • 2021-02-18
    62 min

    336KNB-142 A married woman who answered in a graceful tone, “It costs money to get along with a mama friend, earning pocket money secretly from her husband”, when it comes to SEX, she likes it a lot! The specs that are incomparable to her h

  • amateur censoredcreampiemarried womanknbknb-142knb142336knb-142
    • 2021-03-01
    146 min

    [DKWT-007]This Dirty Married Woman Is So Hot She Should Be Declared A Natural Treasure Amu Hanamiya 28 Years Old Third Year Of Marriage

  • hanamiya amu censoredbig titssquirtingDKWTofficeyoungDKWT-007DKWT00736dkwt00007
    • 2021-03-03
    190 min

    [PFES-021]3 Years Ago, She Worked At A Uniform Display Shop, And Now She's Bought Back Her Super Erotic Absolutely Top Notch Masturbatory Peeping Videos From Her Customers And Selling Them Herself!! Mikako Horiuchi

  • mikako horiuchi censoreduniformamateurPFESkawaiitake dsummer panties festivalPFES-021PFES021pfes00021
    • 2021-03-14
    26 min

    FC2PPV 1725967 A 〇 Ren-Taiho 〇 Cosplay Saddle ♥ Feeling Blow and Horse Riding Fucking Service ♪ Finally, Ejaculation in the vagina with W piece! [Review benefits available]

  • amateur uncensoredfc2
    • 2021-03-15
    50 min

    492MERC-248 Former Ekiden player.

  • amateur censoredamateurmercmerc-248merc248492merc-248
    • 2021-03-18
    82 min

    [REBD-542]Iyona What Happens When I Spend Some Time With My Indoor-Loving Girlfriend Iyona Fujii

  • iyo fujii censoredsingle workREBDrebeccachikara sawamuraREBD-542REBD542h-346rebd00542
    • 2021-03-18
    125 min

    [SPRBD-047]Why Do I Make Love/Amu Hanamiya

  • censoredbig titsbeautiful girlSPRBDintec incSPRBD-047SPRBD047h-706sprbd00047
    • 2021-03-20
    87 min

    [VNDS-3362]I Can't Tell My Husband Until The Day I Die... Forty Something Wife Fucked By Her Step Son Hitomi Oshima 40 Years Old

  • hitomi kojima censoredbig titsmature womanVNDSstar paradisenext toilet r eVNDS-3362VNDS3362h-254vnds03362
    • 2021-03-27
    95 min

    [VEMA-161]My Beautiful Teacher Is The Homeroom Teacher And My Lover ~ Forbidden Passionate Raw Sex All Day With My Older Girlfriend ~ Yukino Nagasawa

  • yukino nagasawa censoredcreampiemarried womanVEMAvenustamatsuka bingogoddess venusVEMA-161VEMA161vema00161
    • 2021-03-30
    58 min

    FC2PPV 1747689 * Limited time 2980pt ★ First shot amateur ☆ Active JD ♥ Former swimmer and muscular BODY leaf Kana-chan 20 years old ☆ Bright erotic girl ♥ Electric massager continuous Iki ♥ Creampie in a tight-fitting shaved pussy ♥ [Personal shooti

  • amateur uncensoredfc2
    • 2021-04-05
    82 min

    FC2PPV 1755787 [Thank you for selling out 100 bottles for the first time for 3 hours] Permanent preservation version ❤️ I can not take the next schedule ❤️ A slender and very beautiful young wife ❤️ Complete appearance of determination ❤️ Perfect voi

  • amateur uncensoredfc2
    • 2021-04-18
    143 min

    [KATU-081]Beautiful Woman x Big Tits x Big Ass Picking Up Super Slutty Wives Girls With Their Asses Bursting Out Of Their Mini Skirs Are Total Nymphos!

  • censoredslutKATUkatsuo bussan mousouzokumaglowKATU-081KATU081katu00081
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-02
    92 min

    [VENX-034]I Stuck My Dick In My Mother-in-Law's Ass Thinking It Was My Wife Honoka Kimura

  • honoka kimura censoredcreampiemature womanVENXvenuspeterfakecest winntersVENX-034VENX034venx00034
    • 2021-05-08
    120 min

    [MDTM-724]This Excessively Sensual Married Woman Who Had Plenty Of Lust To Spare Remained Celibate For A Month, And Because Her Husband Was Shooting Blanks And Suffering From Erectile Dysfunction, She Went To A High-Class Hotel With A Big Dick Single

  • himesaki hana censoredcreampiebig titsMDTMuchu kikakutodoMDTM-724MDTM724mdtm00724
    • 2021-05-15
    125 min

    [MOPT-007]The Best Prostitute, Who Turns Masochistic Men Crazy By Bringing Them To The Edge Of Climax And Then Repeatedly Making THem Pull Out - Ameri Hoshi

  • star ameri censoredanalslutMOPTm o paradisemo tightMOPT-007MOPT007mopt00007
    • 2021-05-31
    66 min

    SIRO-4541 [First shot] [Mochi skin x huge breasts JD] [Waist moves ..] A shy and serious music college student has natural huge breasts. Sensitive she who moves her waist freely when she feels comfortable .. AV application on the net → AV experience

  • amateur censoredbig titsamateursirosiro-4541siro4541siro-4541
    • 2021-06-10
    159 min

    [MIST-339]On The Unsafe Day!! Creampie Soapland 29 Kururugi Aoi

  • aoi kururugi censoredcreampiesingle workMISTmr michirusaitaMIST-339MIST3391mist00339
    • 2021-07-02
    68 min

    FC2PPV 1899108 066 [Creampie & Facials] Creampie & Infinite Facials Sex with a Big-Chicked Adult 1st Year OL On The Way To Work (Big Breasts x God Style x Bukkake)

  • amateur uncensoredfc2
    • 2021-07-10
    121 min

    [CEMD-032]Two Mature Women Making Each Other Cum! Next to Them, Yet Another Mature Women Couple Make Each Other Cum! The Pinnacle of Nonstop Mature Women Lesbian Sex!

  • good miki ryoko izawa miki yoshii viewing moon bookmark censoredlesbianmature womanCEMDceleb no tomoCEMD-032CEMD032cemd00032
    • 2021-09-02
    76 min

    FC2PPV 2125468 980 Yen! I Want You To Do This Kind Of Work ♪ Marunouchi Ol Takes A Half Break And Has Sex In A Suit! Even If The Suit Gets Wet Due To Squirting, There Are Also 3 Vaginal Cum Shots & Semen Bukkake On The Suit From The Ass Job ♪ Iroh

  • amateur uncensoredfc2
    • 2021-09-02
    15 min

    FC2PPV 2130911 [Individual Shooting] Metropolitan Handicraft Club ② G Cup Long Black Hair And Glaring Sex Gonzo Unavoidably For 〇

  • amateur uncensoredfc2
    • 2021-09-11
    151 min

    [SABA-723]Neat and Clean Amateur Wives" First Undressing: Fully Naked Masturbation With Fingers Going In And Out

  • censoredbig titsmature womanSABAs kyuu shiroutoSABA-723SABA723saba00723
    • 2021-10-01
    102 min

    [SHKD-969]Shameful W Heroin Negotiations Breakdown, Servant Hot Plays - Ema Asahi, An Ayumi

  • chaoyang ema ayumi an censoredbig titsdramaSHKDattackerskinshi yoru akuSHKD-969SHKD969shkd00969
    • 2021-10-23
    153 min

    [CEMD-072]Fucking, Confusion! Lover Hot Devil"s Fuck Trip! Nanao Nakano -Woman Fucks Confidently With One Hand On Her D***k!

  • nanao nakano censoredmature womansingle workCEMDserebu no tomoCEMD-072CEMD072cemd00072
    • 2021-10-30
    40 min

    H0930 ki211031 Megumi Shirakawa 29years old

  • amateur uncensoredh0930
    • 2021-11-13
    117 min

    [KAGP-203]"I Never Thought An Old Lady Like Me Would Get Her Underwear Stolen ..." 5 This Married Woman Started Feeling Horny Just From The Thought Of Being Recognized Again As A Woman, And That Makes Her An Easy Lay

  • censoredcreampieblowjobKAGPkaguya hime pt mousozokutsumatori no okinakaguya hime ptKAGP-203KAGP203kagp00203
    • 2021-12-03
    218 min

    [WAAA-119]If You Can Put Up With Hotaru Nogi"s Amazing Technique, You Get To Give Her A Raw Creampie SEX!

  • nogi firefly censoredcreampiebig titsWAAAwanz factoryWAAA-119WAAA119waaa00119
    • 2021-12-09
    41 min

    FC2PPV 2503580 A 20-Year-Old Professional Student Who Aims To Become A Voice Actor. The Next Important Throat After Her Life Is Abused With A Blowjob → Facial Cumshot.

  • amateur uncensoredfc2
    • 2021-12-23
    225 min

    [ABW-182]ひたすら生でハメまくる、終らない中出し性交。 膣内射精20連発 渚このみ【MGSだけのおまけ映像付き 10分】

  • amateur censoredcreampiebig titsabwabw-182abw182abw-182
    • 2021-12-24
    216 min

    [HUNTB-166]"No ... We"ll Get Caught!" My Big Stepsister Was Working Remotely From Home, But She"s Dressed Way Too Provocatively! She"s Wearing Suits Up Top And Nothing But Her Underwear Down Below! And While She"s Working She

  • censoredblowjobsisterHUNTBhuntermorikihhh groupHUNTB-166HUNTB166huntb00166
    • 2021-12-31
    48 min

    10musume 010122_01 Happy New Year! I Came To Cleanse Your Penis For The New Year Kozue Kurihara

  • amateur uncensored10musume
    • 2022-01-22
    125 min

    [APNS-273]The Wife Who Became A Sexual Relief Doll At The Construction Camp. Karen Asahina

  • karen asahina censoredcreampiesingle workAPNSaurora project annexyukihiro nasuaurora project anexAPNS-273APNS273apns00273
    • 2022-01-27
    153 min

    [SPRD-1511]The Reality Is That My Father And Older Brother...Fuck My Wife... Hana Haruna

  • haruna hana censoredmature womansingle workSPRDtakara eizokouji takaraaleddinSPRD-1511SPRD151118sprd01511
    • 2022-01-28
    89 min

    326QRO-001 Real Amateur, The First Vaginal Cum Shot. Sex Document Of An Amateur Female Fan Longing For Av Actor Yuto Kuroda

  • amateur censoredcreampieamateurqroqro-001qro001326qro-001



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi