lingerie censored jav slender creampie




FC2BLKHZGDSDABPREDJUFEHODVROYDNACXMEYDSTARSJULSSNIHDKAMIDESANPPPDHNDCHRVADNCAWD

2021-01-03
61 min

10musume 010421_01 With My Friend: Play Red light, Green light With Adult Toy Yu Nagata Haruna Kawai

  • amateur uncensored10musume
    • 2021-01-08
    115 min

    [PARATHD-3083]Penis Ranking List, As Chosen By Porn Actresses Who Sincerely Love Dick From The Bottom Of Their Hearts: Complete Edition

  • miori hara sana mizuhara censoredlesbianPARATHDparadise tvPARATHD-3083PARATHD3083parathd03083
    • 2021-01-08
    48 min

    FC2PPV 1620918 [Limited quantity] Gachi hidden shooting ❤️ H cup beauty big breasts business trip men’s beauty treatment salon hidden shooting with 3 cameras ❤️ Immediately deleted if barre

  • amateur uncensoredfc2
    • 2021-01-12
    483 min

    [SDMM-082]The Magic Mirror Number Bus Deluxe, Exclusively Filmed Footage Of 12 Girls! 3 Titles, Filled With Beautiful Girls In Swimsuits 2-Disc Set, 480 Minutes! Only Girls We Successfully Fucked Using Whatever Means Possible Enclosed Here In This Vi

  • censoredamateurSDMMsod createafro takahashimagic mirrorSDMM-082SDMM0821sdmm00082
    • 2021-01-13
    62 min

    10musume 011321_01 Slap Sanctions on Smartphone Zombie Aya Nakagawa

  • amateur uncensored10musume
    • 2021-01-15
    80 min

    FC2PPV 1646453 [First time limited 1980] Club picked up club love active JD ❤️ I was allowed to take a gonzo when I was in contact ❤️ Full erection with self-Irama ❤️ A large amount of vaginal cum shot with a meat stick woofer ❤️

  • amateur uncensoredfc2
    • 2021-01-21
    213 min

    [DANDY-747]It's great fucking a serious woman ! Neat and Clean Looking Nurse Turns out to be a Crazy Slut vol. 4

  • censoredblowjobslutDANDYdandymongolian sanoDANDY-747DANDY7471dandy00747
    • 2021-01-25
    67 min

    SIRO-4362 [First shot] [Female college student who likes vagina back] [Daddy service] 19-year-old simple female college student. An innocent girl climaxes many times with tears in the pleasure of her favorite vagina back .. Application amateur, first

  • amateur censoredamateursirosiro-4362siro4362siro-4362
    • 2021-02-08
    66 min

    SIRO-4412 [First shot] [Miniskirt panchira] [Naughty F milk] F milk girl’s naughty pussy overflows lewd honey every time she pokes a big cock .. AV application on the net → AV experience shooting 1461

  • amateur censoredbig titsamateursirosiro-4412siro4412siro-4412
    • 2021-02-11
    47 min

    FC2PPV 1681608 [Individual shooting] The silent and dark J system suddenly changes with back dirt! Daddy active circle light without contraception [Creampie]

  • amateur uncensoredfc2
    • 2021-02-12
    148 min

    [IPX-618]It's Not Cheating If You Only Use Your Mouth, Right？ Lies Aren't The Only Things Women's Mouths Are Good For... Cheating Blowjob Infidelity Feature Tsumugi Akari

  • akari tsumugi censoredcreampieblowjobIPXidea pocketdishIPX-618IPX618ipx00618
    • 2021-02-19
    67 min

    FC2PPV 1693268 [Big ass mistress] I was abstinent for a month and went crazy! Dada leaked glossy pantyhose Creampie while wearing clothes!

  • amateur uncensoredfc2
    • 2021-02-19
    240 min

    [MBM-271]Is Your Wife OK？! She'd Cheat With Somebody Like This？! This Is Unbelievable... Prim, Pretty, Shy, And Serious Wives Have Cheating Creampie Sex Vol. 3 12 Girls, 4 Hours

  • censoredcreampieamateurMBMprestigembmMBM-271MBM271118mbm00271
    • 2021-02-20
    151 min

    [GS-2008]Married Woman Hot Water Love Trip 137

  • censoredmarried womanGSgostakeshi karakiGS-2008GS2008
    • 2021-03-06
    150 min

    [SHKD-930]An Aphrodisiac-Laced Full Body Erogenous Zone A Proudly Independent Female Detective Who Was Dominated Through Sex Kana Yume

  • kana yui censoredsquirtingsingle workSHKDattackersbungo maedasharkSHKD-930SHKD930shkd00930
    • 2021-03-09
    138 min

    [STARS-342]She Committed Adultery Only Once, But She Was Caught In The Act ... This Is The Story Of How Her Husband Went Mad And Out Of Control With Jealousy, While She Was Teased Until She Was About To Lose Her Mind, With Her Dripping Wet Pussy Pump

  • iori furukawa censoredcreampiesingle workSTARSsod createkirinsod starSTARS-342STARS3421stars00342
    • 2021-03-13
    143 min

    [IPX-631]This Pay-For-Play College Girl Was Being Pressured By An Underground Loan Shark And Now Her Life Was Ruined In This Video Yume Nishimiya

  • yume nishinomiya censoredsingle workIPXidea pocketdishIPX-631IPX631ipx00631
    • 2021-03-20
    60 min

    10musume 032021_01 Amateur girl addicted to kinky sex with middle-aged man Kazumi Okada

  • amateur uncensored10musume
    • 2021-04-10
    63 min

    300NTK-550 [Cute & Beautiful Quarter Nice Bottom Beautiful Girl! !! ] Reiwa is so cute, but I like anime! !! It’s a star of otaku! !! Continuous vaginal ejaculation is inevitable with the discovery of "SEX is … I like rawness" !!

  • amateur censoredcreampieamateurntkntk-550ntk550300ntk-550
    • 2021-04-14
    204 min

    496SKIV-009 Nao-chan (21)

  • amateur censoredcreampiebig titsskivskiv-009skiv009496skiv-009
    • 2021-04-23
    555 min

    [LXV-044]【期間限定販売】【MGSだけのおまけ映像付き 75分】ラグジュTV×PRESTIGE PREMIUM 42 オトナのエロさここに極まる！美女達の本当の姿を余すところなく全部見せます！！

  • amateur censoredcreampiebig titslxvlxv-044lxv044lxv-044
    • 2021-04-29
    95 min

    [IQQQ-023]A Married Teacher Gets 10x Wet In An Orgasm Class Where She Can't Make A Sound! Yumiko Sakura

  • yumiko sakura censoredcreampiemarried womanIQQQcenter villagejiro fukagawazora center villageIQQQ-023IQQQ023h-086iqqq00023
    • 2021-05-08
    46 min

    H0930 ori1601 Yasuka Sakakiyama 28years old

  • amateur uncensoredh0930
    • 2021-05-13
    20 min

    HEYZO 2520 Erotic Massage for Reina – Reina Shiraishi

  • amateur uncensoredblowjobheyzo
    • 2021-05-19
    135 min

    [GVH-233]Big Titted Servants Mao Hamasaki /Akari Niimura

  • hamazaki mao akari shinmura censoredbig titsslutGVHglory questusubashi suiGVH-233GVH23313gvh00233
    • 2021-05-21
    147 min

    [HND-984]She Just Cheated On Her Brand New Boyfriend... But Only Because She Wanted To Get Better At Sex For Him, She Swears! Slut With Short Hair Makes Her Creampie Debut! Rina Uchida

  • rina uchida censoredblowjobbeautiful girlHNDhon nakausa pyonHND-984HND984hnd00984
    • 2021-06-04
    120 min

    [NGOD-149]Being Felt Up By A Millionaire...Wife With Big Tits Gets Fucked By A Charismatic Investor Hana Haruna

  • haruna hana censoredbig titsmature womanNGODjet eizomanji groupNGOD-149NGOD149ngod00149
    • 2021-06-16
    177 min

    [SSIS-097]His Relentless Furious Second-Helping Piston-Pounding Thrusts Were Pumping Her Creamy Cunt As Her Marshmallow-Soft G-Cup Titties Were Jiggling And Wiggling During 3 Massively Spasmic Ultra Creampie Fucks Mahina Amane

  • amane mahina censoredbig titssquirtingSSISs1 no 1 stylebungo maedaSSIS-097SSIS097ssis00097
    • 2021-06-17
    150 min

    [CMV-155]Ballerina Tied Up Tight With Rope Pretty Girl Has Her Pussy Relentlessly Played With Riri Momoka

  • peach scent censoredcosplaybdsmCMVcinemagicmarukatsuvixenCMV-155CMV155cmv00155
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-26
    57 min

    FC2PPV 1889535 [Personal shooting] Kure is 18 years old with beautiful legs and big tits and vaginal cum shot in a convulsive pussy. [Mountain shooting]

  • amateur uncensoredfc2
    • 2021-07-10
    195 min

    [TPIN-006]Amateur Bouncing Boobs TV H Cup Nurse Mei (25) Single

  • censoredbig titsnurseTPINchinpoinTPIN-006TPIN006tpin00006
    • 2021-07-17
    123 min

    [HMN-018]What？ Cumming with just a Nipple Touch？ No Hands Fondling Makes Her Cum Hard! No Need for this Girl to Calm Down After Cumming Before Getting Creampied. Minami Hatsukawa

  • hatsukawa minami censoredcreampieslutHMNhon nakasamoariHMN-018HMN018hmn00018
    • 2021-07-22
    120 min

    [MIAA-477]Female Detective Sneaks In As A Decoy! Aphrodisiac Oil Bondag With Endless Orgasms Version Sakura Tsuji

  • sakura tsuji censoredcreampiebig titsMIAAmoodyztrendy yamaguchieveryone s porn starMIAA-477MIAA477miaa00477
    • 2021-08-09
    42 min

    FC2PPV 1975655 First Shot! !! Appearance! !! Limited Number! [Uncensored] Creampie Twice To The Older Sister At The Reception Of A Certain Mobile Phone Shop That I Longed For! !! Begging For A Beautiful Appearance For The Second Time! !! (Feature Fil

  • amateur uncensoredfc2
    • 2021-08-13
    141 min

    [BLK-512]Sudden Reverse Pick Up Harem Wagon! If You"re Going To Have Sex With Dull Women, Better Fuck With Us!! Nene Tanaka, Ruka Inaba

  • nene tanaka inaba censoredcreampieslutBLKkira kirasamoarikira hosi kira black galBLK-512BLK512blk00512
    • 2021-08-18
    98 min

    [ZOZO-073]A Physical Examination From The Immoral Health Care Provider Who Goes After High S*********ls - The Rei Edition -

  • censoredcreampieZOZOsadie willenauZOZO-073ZOZO0731zozo00073
    • 2021-08-20
    135 min

    [JUL-686]Unending Days of Creampie G*******gs Kana Yume

  • kana yui censoredcreampiemature womanJULmadonnaunicorn fukudaJUL-686JUL686jul00686
    • 2021-09-10
    161 min

    [BANK-052]Busty Wife Hot Spring Date. Gentle Slow Paced Genuine Married Woman. J-cup Akane, 28 Years Old.

  • censoredcreampiebig titsBANKma ko ginkoutakechanBANK-052BANK052h-1495bank00052
    • 2021-09-11
    230 min

    [NASH-568]The Showa Theater Of Life And Love: A Nun, A Widow, And A Mature Woman"s Lewd Drama

  • censoredmature womandramaNASHpinkbig brothernadeshikoNASH-568NASH568nash00568
    • 2021-09-24
    150 min

    [SSIS-185]My Bride"s Bizarre Infidelity Is Terrible, Just Too Terrible - Ichika Hoshimiya

  • ichika hoshimiya censoredsingle workSSISs1 no 1 stylekannana dainanaSSIS-185SSIS185ssis00185
    • 2021-09-28
    142 min

    1Pondo 092821_001 Saori Miyazawa : Saori Miyazawa Special Edition

  • amateur uncensored1pondo
    • 2021-09-30
    87 min

    435MFC-146 [2 In 2 Facial Cumshots 3P Gonzo] 2 Full Erection Meat Sticks Attack Mako Of Beautiful Big Tits H Cup Saffle! In The First 3P, Both The Upper Mouth And The Lower Mouth Are Filled With Cheeks And I Am Very Excited! Enchantedly In A Heavenly

  • amateur censoredcreampiebig titsmfcmfc-146mfc146435mfc-146
    • 2021-10-16
    92 min

    [SUJI-144]Creampie Sex With A Big Tits Beautiful Y********l In Uniform H-Cup Titties Riho Riho Takahashi

  • riho takahashi censoredcreampiebig titsSUJIkan ran monoSUJI-144SUJI144suji00144
    • 2021-10-16
    140 min

    [GMEM-047]ULTRA SWEET Check Out Those Red Bearded Clams A Young Lady Descends Into A Hell Of Infinite Orgasms - Hear Her Crazy Pussy Scream As Her Untainted Cunt Is Soiled With Powerful Orgasms - Sachiko

  • sachiko censoredbig titssingle workGMEMavsbaba za babiiavscollector s goldGMEM-047GMEM047gmem00047
    • 2021-10-16
    12 min

    FC2PPV 2350291 A Two-Day, One-Night Trip To Kansai With Erika! Erika-Chan Is Naughty Even During A Date!

  • amateur uncensoredfc2
    • 2021-10-22
    54 min

    FC2PPV 2364567 [New Work, Half Price! ] ♀ 250 Reading More ◯ -Chan 18 Years Old 11th Time A Beautiful Girl Of The Active J Generation Is Contraceptive With A Dirty Race Queen Costume And Conceived In A Contraceptive Ma ◯ Co And Cum Shot Seeding Raw S

  • amateur uncensoredfc2
    • 2021-11-02
    83 min

    451HHH-033 [Chi ● Po Is The Staple Food Race Queen] [Highleg X Golden Legs] [Fcup’s Obscene Pink Areola] Chi ● Po Is Happy Yoshiyoshi ♪ After More Than 100 Experienced People ● Po Love Is Here Now Overflow! The Figure That Licks The Back Muscles

  • amateur censoredcreampiebig titshhhhhh-033hhh033451hhh-033
    • 2021-11-13
    120 min

    [AQSH-079]Shoplifting Housewife Since Your Breasts Look So Delicious, Instead Of Reporting You The Perverted Shop Manager Will Just Fuck And Creampie You Without Your Permission Tani Azusa

  • azusa tani censoredcreampiebig titsAQSHaqua mall heroaqua mallAQSH-079AQSH079aqsh00079
    • 2021-11-19
    160 min

    [SSIS-249]This Beautiful Girl Has G-Cup Titties And She"s Not Wearing Her Bra, Because She"s Exposing Her Big Tits And Putting Her All Into A Full-Frontal Appeal An Instantly Lucky Ejaculation Situation Mahina Amane

  • amane mahina censoredbig titsbeautiful girlSSISs1 no 1 stylegoemonSSIS-249SSIS249ssis00249
    • 2021-12-04
    123 min

    [GVH-326]Cunt Device Bondage, XXIV. Tied Up in Iron. Cunt Play. Nana Maeno

  • nana maeno censoreddeepthroatsingle workGVHglory questGVH-326GVH326gvh00326
    • 2021-12-14
    35 min

    FC2PPV 2514772 [No Eye Moza] Prefectural General Course ③ Weekly ○ Gonzo With Bloomers On Uniform Gals Having Sex * Limited To 100

  • amateur uncensoredfc2
    • 2021-12-18
    75 min

    H4610 tk0049 Minami Hamajo 19years Old

  • amateur uncensoredh4610
    • 2021-12-19
    61 min

    [121921-001]The Girl with Snow White Boobs

  • mai amao uncensoredcreampiehandjobcaribbeancom
    • 2022-01-02
    69 min

    530DG-045 "Do You Want To Graduate？" Female Student’s Live Supplementary Lesson ＃ 01

  • amateur censoredcreampieschoolgirldgdg-045dg045530dg-045
    • 2022-01-20
    126 min

    [MTALL-009]Keeping Her To Persuade Her. Arisu Otsu.

  • seina arisa censoredanalbig titsMTALLmaterialltakuanMTALL-009MTALL009



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi