madoka




FC2RBDWANZBLKAUKGATIDAUKSABWROYDMVSDHMNSANPREDMARASPRDPPPDDASDWAAACAWDMILKDTT

2020-09-15
125 min

1Pondo 091520_001 Saori Okumura: Saori Okumura Special Edition

  • amateur uncensored1pondo
    • 2020-09-27
    49 min

    FC2PPV 1515983 [Personal shooting / original] Be careful of your mouth! Shaved and streaky man that you can see ♪ In addition, a beautiful girl with outstanding sensitivity has appeared ♥ * High quality version & review benefits included ♪

  • amateur uncensoredfc2
    • 2020-10-02
    59 min

    [KBTV-032]Are Women Who Accompany Tipsy Men Home Actually Looking To Fuck？ A Theory

  • censoredcreampiesquirtingKBTVgoing too far tvKBTV-032KBTV032h-1514kbtv00032
    • 2020-10-12
    54 min

    FC2PPV 1531749 [Limited quantity 2980pt → 1980pt] That super famous doujin AV actress volunteers for a massage model ❤️ Rubbing beautiful big tits covered with oil ❤️ Screaming with brain juice in hell that can not be squid ❤️ There is a vaginal cum

  • amateur uncensoredfc2
    • 2020-10-13
    135 min

    [MSFH-034]I Spent A Week Fucking The Shit Out Of An I-Cup Titty Real-Life College Girl And Enjoying Her Spectacular Body, After Signing A Lover's Contract With Her Moe Maeda

  • maeda momoko censoredcreampiebig titsMSFHsod createsuisei akaims sodMSFH-034MSFH0341msfh00034
    • 2020-10-17
    161 min

    [DVDMS-593]Pale Rural Beauties - In-Home Adultery With Married Sluts The From The Countryside. One Whole Day Of Sweaty, Passionate Sex Plus A Cheating Creampie. 34-Year-Old Yoga Instructor Tomomi Kanda

  • censoredcreampieamateurDVDMSdeep sking of genkingDVDMS-593DVDMS593dvdms00593
    • 2020-10-23
    273 min

    [SKMJ-128]Seducing An Amateur College Girl For A Real Pickup! This Innocent And Beautiful Girl Is Having Her First Female Readers Choice Sex Club Experience! 3 4 Pairs Of Amateur Girls & Handsome Guys Having Forbidden Sex

  • censoredcreampieamateurSKMJred face girlyuseiSKMJ-128SKMJ128h-1324skmj00128
    • 2020-11-01
    120 min

    [UKM-003]Adultery Hot Springs: Wet And Erect vol. 3

  • censoredmarried womanmature womanUKMflowers and honeyshohei shimaUKM-003UKM003ukm00003
    • 2020-11-01
    124 min

    [JJAA-042]A Married Woman Takes An Employee Into The Break Room At Her Part Time Job For Some Private Fun 17

  • censoredcreampiemature womanJJAAjukujo japanJJAA-042JJAA042jjaa00042
    • 2020-11-04
    79 min

    ION-068 Yui

  • amateur censoredsquirtingamateurionion-068ion068ion-068
    • 2020-11-05
    93 min

    [mgmr-129]NENENE(20)

  • amateur censoredbig titsamateurmgmrmgmr-129mgmr129mgmr-129
    • 2020-11-25
    73 min

    [SHMO-182]Venus Terme/Kaori Arisue

  • nishinomiya mitsuki censoredsoloworkSHMOorustak softSHMO-182SHMO182
    • 2020-12-01
    57 min

    C0930 ki201201 Yiu Higashiyama 33years old

  • amateur uncensoredc0930
    • 2020-12-02
    140 min

    [ARM-927]Massage Parlor With No-Ejaculation Policy But The Girls Keep Pushing Their Tits In My Face And Finally Bring Me To Cum While Pretending It's Accidental

  • censoredbig titsARMaroma planningshigeo kadowakiaromaARM-927ARM927arm00927
    • 2020-12-04
    64 min

    FC2PPV 1594395 [Big breasts OL / orgy individual shooting] Large set of individual shooting craftsmen! Kcup Miracle Big Breasts OL & Rookie OL Get ☆ Orgy Party with Kopa with Ai ○! [Of course, raw vaginal cum shot]

  • amateur uncensoredfc2
    • 2020-12-10
    141 min

    [MIST-322]Ass Hell - A Super Sadistic Slut Who Will Plant Her Alluring Big Ass On Men's Faces And Put Them Through Face-Sitting Hell While Getting Their Dicks Rock Hard And Ready For Creampie Sex - Yurika Aoi

  • yurika censoredcreampiesingle workMISTmr michirumiyoshi rusherMIST-322MIST3221mist00322
    • 2020-12-24
    119 min

    [RCTD-371]Naked Oil Kat Lesbian Fight 3

  • yuki sakuragi mari kaga censoredlesbianRCTDrocketscarecrowRCTD-371RCTD3711rctd00371
    • 2020-12-24
    135 min

    [TOEN-036]Her Husband Doesn't Know She's Doing Porn - Married Woman With Soft Tits And A Big Booty - Shiho Kurio, Age 39

  • shiho kurio censoredcreampiemarried womanTOENcenter villageyoichi sanotaoyuanTOEN-036TOEN036h-086toen00036
    • 2020-12-24
    59 min

    SIRO-4375 [First shot] [Holiday teacher is an obscene T-back] [Serious climax that shakes the waist] 〇 〇 A cram school teacher who teaches mathematics participates in the war. Madonna’s foolery that fascinates me while being ashamed .. AV applic

  • amateur censoredsquirtingamateursirosiro-4375siro4375siro-4375
    • 2020-12-29

    FC2PPV 1624352 [Appearance / 3p] I lent money to my friend, but he didn’t return it, so I took my sister for interest.

  • amateur uncensoredfc2
    • 2021-01-01
    142 min

    [DROP-053]Amateur Girls Their First Time Working Part-Time Washing Dicks 4

  • censoredamateurblowjobDROPoffice k sdrop office k sDROP-053DROP05336drop00053
    • 2021-01-23
    62 min

    1Pondo 012321_001 Braless Neighbor In The Morning: Sakiko Mihara

  • amateur uncensored1pondo
    • 2021-01-24
    100 min

    [SRMC-028]Sensual Approach Of A Big Butted Wife Reiko Kobayakawa

  • kobayakawa reiko censoredslutsingle workSRMCh m rashmiyoshi rusherSRMC-028SRMC028srmc00028
    • 2021-02-05
    51 min

    FC2PPV 1673368 Super Sensitive Shortcut Beautiful Slender Chippai Pan Pet Shop Clerk Life’s First Gonzo

  • amateur uncensoredfc2
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-19
    58 min

    SNYZ-019 Aria-chan

  • amateur censoredamateurcosplaysnyzsnyz-019snyz019snyz-019
    • 2021-03-12
    48 min

    FC2PPV 1723477 [Sale for a limited time] I don’t wear Udonge-chan! 2 shots to a horny rabbit Irama & vaginal cum shot & ass bukkake! It’s a rabbit that can be used a lot!

  • amateur uncensoredfc2
    • 2021-03-20
    120 min

    [NXG-361]Blushing Amateur Wife Can't Believe She's So Wet And Horny After Taking A Shameful High Paying Job...

  • censoredamateurcosplayNXGstar paradisenext groupNXG-361NXG361h-254nxg00361
    • 2021-03-24
    156 min

    496SKIV-006 Jun-chan 2 (26)

  • amateur censoredcreampieamateurskivskiv-006skiv006496skiv-006
    • 2021-03-26
    45 min

    359TYVM-141 Plump Glamor Young Wife Portio Cum Squirting Sex! !!

  • amateur censoredcreampiebig titstyvmtyvm-141tyvm141359tyvm-141
    • 2021-04-03
    244 min

    [UMSO-388]6 Pantyhose-wearing Beautiful Women

  • makoto ito natsuho imai censoredUMSOkm produceumanamiUMSO-388UMSO388umso00388
    • 2021-04-12
    59 min

    345SIMM-633 [Virgin brush down] If you confess your virginity to a childhood friend with short hair and outstanding style, you can do it! Three consecutive vaginal cum shots on "Manami" who has a cute face and is good at the floor!

  • amateur censoredcreampieamateursimmsimm-633simm633345simm-633
    • 2021-04-21
    69 min

    259LUXU-1403 Luxury TV 1394 A beautiful president’s secretary makes an AV appearance saying "I want to taste the pleasures I do not know yet"! When the slender body is blamed carefully, a splendid nipple erects splendidly! Pleasure penet

  • amateur censoredamateurluxuluxu-1403luxu1403259luxu-1403
    • 2021-05-02
    61 min

    [050221_001]エンドレスセックス 七海なな

  • amateur uncensored1pondo
    • 2021-05-10
    99 min

    300MIUM-707 Big Cock 100 Slashing Big Butt Wife! !! !! [Dirty wife caught for big dick] → Ji ● If you ask me to get up, [Shake the big cock and show off a thick dildo masturbation! ] Gingin erection Chi ● Sucking on Po! !! Raw insertion from drooling

  • amateur censoredcreampiemarried womanmiummium-707mium707300mium-707
    • 2021-06-01
    120 min

    [NACR-427]A Wife Who Likes Licking - Ran Mukai

  • ai mukai censoredblowjobsingle workNACRplanet plusbito sakurananakuruNACR-427NACR427h-237nacr00427
    • 2021-06-05
    241 min

    [MMB-368]8 Effective Ways S********ls Can Make Older Men Fall In Love

  • jinguji temple nao aoi kururugi censoredschoolgirlbeautiful girlMMBmomotaro eizohakase ishikiribashimomotaro s bestMMB-368MMB368mmb00368
    • 2021-06-12
    240 min

    [NASH-519]Family Lesbians Chapter 6

  • rieko hiraoka mio morishita censoredbig titsmarried womanNASHpinknadeshikoNASH-519NASH519nash00519
    • 2021-06-19
    240 min

    [CJOB-090]Bondage Play With A Sadistic Beauty - I Can't Move, And She Makes Me Cum Again And Again! BEST

  • emi fukada hasumi claire censoredslutCJOBslut havenslut haven bestCJOB-090CJOB090cjob00090
    • 2021-06-20
    126 min

    [CEMD-024]Screaming! Fainting! Working That G-Spot! Coming So Far Into Hana Shirato That It Reaches The Back Of Her Womb

  • white peach censoredmature womanbeautiful girlCEMDceleb no tomoCEMD-024CEMD024cemd00024
    • 2021-06-22
    135 min

    [KIRE-040]Extremely pretty! Starring both Akane Soma and Mariko Sata A blowjob-crazy housewife orders food, seduces the young delivery guy, and pulls away during successive ejaculations! 8 cum shots in total

  • mariko sada soma censoredcreampiemature womanKIREsod createsakai shiberiarei kirei sodKIRE-040KIRE0401kire00040
    • 2021-06-25
    182 min

    [JUFE-301]Specializing In Men's Nipples! Sensitive Clit Nipples Fainting In Ecstasy Salon Ranka

  • ranka censoredcreampiebig titsJUFEfitchJUFE-301JUFE301jufe00301
    • 2021-07-06
    59 min

    FC2PPV 1906372 [Appearance] Two times of vaginal cum shot at the hotel with fair-skinned bangers and translation ants

  • amateur uncensoredfc2
    • 2021-07-06
    80 min

    469G-647 Imadoki Girls’ Yen Exchange (Daddy Activity) Circumstances! Cherry Blossoms

  • amateur censoredcreampiebig titsgg-647g647469g-647
    • 2021-07-09
    176 min

    [IPX-681]Gachimaji Major Top Secret AV Debut of a Real Idol. Mano Yoda.

  • mano yoda censoredbeautiful girlsingle workIPXidea pocketusa pyondishIPX-681IPX681ipx00681
    • 2021-07-14
    127 min

    [ARM-999]How Would You Like To Have Your Hard Cock Secured Up Against Your Stomach While Being Roughly Jacked Off？

  • blue miu susaki censoredsluthandjobARMaroma planningshigeo kadowakiaromaARM-999ARM999arm00999
    • 2021-07-15
    61 min

    FCP-029 [Delivery Only] You Can Do It Even If It’s Small! !! Super Feeling Good! Fucking! 2

  • amateur censoredamateurbeautiful girlfcpfcp-029fcp029fcp-029
    • 2021-08-03
    57 min

    422ION-0076 I Decided To Shoot Her At The Hotel When My Boyfriend Met On SNS That I Was Not Satisfied With In A Light Night! !!

  • amateur censoredamateurbeautiful girlionion-0076ion0076422ion-0076
    • 2021-08-13
    240 min

    [OOMN-275]A Slender, Beautiful Girl Agonizes By Instinct and Reaches Her Climax. Mitsuha Higuchi.

  • mitsuha higuchi censoredbeautiful girlOOMNabc delusion groupmom.com abc delusion groupOOMN-275OOMN275oomn00275
    • 2021-08-17
    30 min

    275OCHA-093 Hibiki

  • amateur censoredcreampieamateurochaocha-093ocha093275ocha-093
    • 2021-09-04
    120 min

    [KSBJ-155]Adultery At Home, Behind My Husband"s Back. Amu Hanamiya

  • hanamiya amu censoredslutsingle workKSBJksb kikaku emmanuellesakura ninKSBJ-155KSBJ155ksbj00155
    • 2021-09-18
    120 min

    [ZOCM-006]Unexpected Room Sharing At Hotel. NTR Getting Cheated On. Cute Clumsy Female Employee And Dull Boss (Married) Enjoy Never Ending Adultery At Work. 1 Year Since Cute Seductress Joined Admin Dept. 22-Year-Old Nanami-chan. Nanami Yokomiya

  • yokomiya nanami censoredcreampiebig titsZOCMzokuzoku musume mousouzokutodozokuzoku musumeZOCM-006ZOCM006zocm00006
    • 2021-09-24
    101 min

    [YSN-559]My New Sister-In-Law Is A Devil, But My Erection Doesn"t Go Away. Mao Hamasaki

  • hamazaki mao censoredcreampieblowjobYSNnonYSN-559YSN559h-127ysn00559
    • 2021-10-07
    169 min

    [SUN-031]A Cum D***king Beauty A Dick-Sucking Exhibitionist Date With A Massage Parlor Therapist Who Loves To Serve

  • anne mashiro censoredbig titssingle workSUNsuntanaka baconSUN-031SUN03113sun00031
    • 2021-10-16
    111 min

    [SCD-197]The 50-Year-Old Mother Is A Slut With A Cute Smile And Beautiful Breasts Gives Me An Aphrodisiac Rinka Satsuki

  • rinka satsuki censoredslutmomSCDrubytsuji koujisecret rubiSCD-197SCD197scd00197
    • 2021-10-28
    53 min

    FC2PPV 2381130 There Is A Reason Why It Has A Petite And Dangerous Scent. The First And Last Gonzo With A Girl Waiting For God! Relentless Raw Insertion From The Cross Missionary Position To Miraculous Beautiful Breasts

  • amateur uncensoredfc2



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi