moon




FC2PREDNACRDASDMARAMIAASTARSNACXBBANAWDHUNTBJULSQTESSISHDKAMIDVDASDMEYDWAAAPPPDVENU

2020-09-05
68 min

300NTK-427 The reward for a beautiful wife with H-cup god huge breasts is … handsome Chi ○ ko! ？ A semi-authorized business trip host eating a middle-breaking husband, a desire on the verge of explosion & a raw chin cowgirl of erotic breast

  • amateur censoredcreampiebig titsntkntk-427ntk427300ntk-427
    • 2020-10-02
    130 min

    [CHN-191]New: We Lend Out Amateur Girls. 92 (Pseudonyms) Hinano Kashii (Community College S*****t) 20 Years Old.

  • kashii hinano censoredanalbig titsCHNprestigemanhattan kimurataiCHN-191CHN191118chn00191
    • 2020-10-02
    182 min

    [ABW-013]You Can't Make A Sound... As You Secretly Make Lovey-Dovey Love "Close And Tight" Sex Vol.02 3 Cum-Filled Total Coverage Fuck Fests In Never-Before-Experienced Tight Quarters Airi Suzumura

  • suzumura airi censoredsquirtingdeepthroatABWprestigemasarupansaabsolutely wonderfulABW-013ABW013118abw00013
    • 2020-10-24
    146 min

    [DASD-752]The Domain Of Her Holy Golden Waters This Beautiful Secretary Received Breaking In Pissing Training From Her Critical President And Now She's Dripping Piss Down Her Marshmallow-Soft Skin And Thighs. Rika Tsubaki

  • tsubaki rika censoredbeautiful girlsingle workDASDdasgoemonDASD-752DASD752dasd00752
    • 2020-11-01
    155 min

    [GS-1993]Married Woman Hot Water Love Trip 135

  • censoredmarried womanGSgosGS-1993GS1993h-101gs01993
    • 2020-11-12
    240 min

    [KNMB-006]Complete Raw Style @ Ms. Nakata Amateur Video Halo 5 Girls 240 Min. #S-Class Beauty Kanon #Sweaty Masochist Mirina #Slender Black Pantyhose Remu #A-Cup Pussy Juice Yui #Minimalist Husky Voice Kanon

  • kanon kanon minami kosaka censoredcreampieschoolgirlKNMBfirst star100 raw styleKNMB-006KNMB006h-491knmb00006
    • 2020-11-13
    240 min

    [XRW-941]電動無限イカセ地獄20人4時間

  • have tomoe nakamura censoredschoolgirlXRWk m producemanjiroureal real worksXRW-941XRW941172xrw00941
    • 2020-12-11
    44 min

    FC2PPV 1602802 [Personal shooting] Infiltrate a secret orgy ㉒ Chubby lewd child ♥ Inject Ossan sperm one after another with a vaginal cum shot ♪ * High quality version & review benefits included ♪

  • amateur uncensoredfc2
    • 2021-01-06
    126 min

    [OVG-161]When He Rubbed His Cock Against Her Pussy, It Felt So Good She Unexpectedly Let Him Slip It In! This Delivery Health Call Girl Usually Didn't Allow Any Fucking, But Now She Was Filming Some Creampie Raw Footage

  • natsuki takeuchi ohara yuria censoredcreampiebig titsOVGglory questOVG-161OVG16113ovg00161
    • 2021-01-08
    62 min

    Pacopacomama 010821_416 Ayumi Tsuji

  • ayumi tsuji uncensoredcreampiebig titspacopacomama
    • 2021-01-14
    51 min

    230OREC-673 Sakura sensei

  • amateur censoredcreampiebig titsorecorec-673orec673orec-673
    • 2021-01-17
    160 min

    [MMKZ-090]A Cute Face And A Big Ass!! Rika Tsubaki

  • tsubaki rika censoredbig titssingle workMMKZmarrionkojiro miyamotoirisMMKZ-090MMKZ090mmkz00090
    • 2021-01-18
    67 min

    328HMDN-329 [Amateur individual shooting] S-class beautiful wife 30 years old where cocks flock and 6 saffle and a horny wife who devours sexual desire and a divisive individual shooting

  • amateur censoredcreampiebig titshmdnhmdn-329hmdn329328hmdn-329
    • 2021-01-28
    82 min

    [opsen-016]カミ

  • amateur censoredbig titsuniformopsenopsen-016opsen016opsen-016
    • 2021-01-29
    58 min

    490FAN-085 Aoi

  • amateur censoredbig titsamateurfanfan-085fan085490fan-085
    • 2021-02-13
    117 min

    [VEC-465]The Married Woman Next Door Seduces Male Virgins With Her Teeny Tiny Panties & Front-Clasp Bra Mio Kimijima

  • kimishima mio censoredcreampiebig titsVECvenussarumegami venusVEC-465VEC465vec00465
    • 2021-02-19
    120 min

    [DDOB-088]Extreme Vaginal Orgasms - Married Woman Who's Never Had One Before Screams And Squirts! Yuri Tadokoro

  • yuri tadokoro censoredcreampiemature womanDDOBdogmatenunmy auntDDOB-088DDOB088ddob00088
    • 2021-02-21
    120 min

    [JUL-479]During Our Business Trip, To My Great, Great, Surprise, I Was Booked Into The Same Business Hotel Room With My Favorite Lady Boss Honoka Kimura

  • honoka kimura censoredmature womansingle workJULmadonnamametaro mamezawaJUL-479JUL479jul00479
    • 2021-02-22
    139 min

    [GENM-073]Cherry Boy Sex - Yuki Yoshizawa

  • yuki yoshizawa censoredbeautiful girlsingle workGENMgenekig 3GENM-073GENM073genm00073
    • 2021-03-04
    76 min

    [REBD-540]Rio: Super Cute And A Quick Change - Rio Kuriyama

  • rio kuriyama censoredsingle workREBDrebeccahaka kureREBD-540REBD540h-346rebd00540
    • 2021-03-18
    235 min

    [HUNTA-975]"Hey Big Stepbrother ... Why Did You Do Such A Thing (Kiss Me) Yesterday？" My Little Stepsister Was Just My Type, So When I Unexpectedly Found Myself Kissing Her ... I Have A Super Cute Little Stepsister. And I Know That We're

  • censoredcreampieschoolgirlHUNTAhuntervolvo nakanohhh groupHUNTA-975HUNTA975hunta00975
    • 2021-03-18
    110 min

    [HUNBL-037]This Naughty Stepdaughter And Little Stepsister Are Getting Some Serious Piston-Pumping Dick-Sucking Action! They Can Cry, They Can Squeal, But They'll Never Be Forgiven! "I Gave You Your Last Chance Already ..."

  • censoredcreampiesisterHUNBLhunterbajiohhh groupHUNBL-037HUNBL037hunbl00037
    • 2021-03-19
    68 min

    [OTIM-060](Delivery Only) (First Peron Fantasy) Big Titty Girl In School Uniform Fucks For Money Rika Aimi

  • rumi tadami censoredcreampieuniformOTIMprestigeonetimeOTIM-060OTIM060118otim00060
    • 2021-03-20
    35 min

    FC2PPV 1734437 [Smooth skin, light cherry-colored nipples] [Face bald benefits available] A beautiful female student I met in Kyoto, Asama ◯ Gonzo! The super beautiful minimum nipple was exposed and the super smooth skin was dyed with a cloudy liquid

  • amateur uncensoredfc2
    • 2021-04-01
    57 min

    FCP-008 [Delivery only] Absolutely subjective! !! Sperm is almost exhausted! Super feeling good! !! Nipple Licking Handjob ＃ 2

  • amateur censoredamateurfcpfcp-008fcp008fcp-008
    • 2021-04-10
    108 min

    [OIGS-038]Married Rope Slut Succumbs To The Pleasure Of S&M And The Ecstasy Of Owned Flesh Chitose Yuki

  • chitose in the evening censoredbig titsbdsmOIGSavs collector susubashisuiavscollector sOIGS-038OIGS038oigs00038
    • 2021-04-12
    103 min

    300MIUM-703 A Transcendental Celebrity Wife Who Wants To Have Sex Four Times A Day! !! !! → [Muchimuchi G milk & plump meat butt naughty body is celebrity grade! !! !! ] × [The appearance of thrusting a thick vibe into estrus Ma ● Ko is really too

  • amateur censoredcreampiebig titsmiummium-703mium703300mium-703
    • 2021-04-24
    126 min

    [TEN-035]Hot Steam Hell - The Rope Hotel - 19 Mizuki Ceiling Ropes Edition - Mizuki Yayoi

  • mizuki yayoi censoredbdsmsingle workTENvan associatesharu tenmatenmaTEN-035TEN035h-859ten00035
    • 2021-04-29
    101 min

    300MIUM-701 [Original model! Beautiful girl advent like a celebrity] Super beautiful legs with an inseam of 87 cm! Desire outbursts with boyfriend and less! !! From the first footjob of my life to the second round at a hotel in a rainy day … Pan

  • amateur censoredamateurmiummium-701mium701300mium-701
    • 2021-05-08
    119 min

    [USBA-026]Aphrodisiac BDSM Becoming A Captive Of Pleasure Hell With Powerful Aphrodisiacs and Bukkake Nene Tanaka

  • nene tanaka censoredbig titssingle workUSBAavs collector ssaburo hiumaavscollector sUSBA-026USBA026usba00026
    • 2021-05-16
    30 min

    FC2PPV 1820702 Cuckold senior throat erotic woman in secret …

  • amateur uncensoredfc2
    • 2021-05-19
    127 min

    [GVH-234]Obstinate Female CEO With A Slutty Body And Her Perverted Step Son Yui Hatano

  • yui hatano censoredcreampiebig titsGVHglory questhyonGVH-234GVH23413gvh00234
    • 2021-05-21
    148 min

    [DASD-868]She Feels Amazing In Your Hands! G-Cup Girl Who Will Let Anyone Do Anything To Her Makes Her Debut Suzume Sho

  • sho suzume censoredbig titssingle workDASDdassuper dryDASD-868DASD868dasd00868
    • 2021-05-23
    169 min

    240TOKYO-427 Urara

  • amateur censoredamateurbeautiful girltokyotokyo-427tokyo427240tokyo-427
    • 2021-05-30
    103 min

    420POW-030 Pompon [Amateur Hoi Hoi power / Saddle shooting / Teen / Beautiful girl / Big breasts / G cup / Plump / School girls / Gal / Shortcut / Uniform / Kansai dialect / Tongue piercing / Sensitive nipple / Launch on tongue]

  • amateur censoredbig titsuniformpowpow-030pow030420pow-030
    • 2021-05-31

    FC2PPV 1844640 First shot !! Limited number !! A female college student who dreams of living together for the first time. On the eve of cohabitation, I pushed the refusal and made vaginal cum shot twice !! (feature)

  • amateur uncensoredfc2
    • 2021-06-10
    44 min

    H0930 ki210610 Eriko Sawaki 32years old

  • amateur uncensoredh0930
    • 2021-06-20
    130 min

    [ONSG-038]Busty Call Girl Miyabi Midorikawa

  • midorikawa miyabi censoredcreampiebig titsONSGgain corporationONSG-038ONSG038onsg00038
    • 2021-07-03
    141 min

    [PKPD-154]Creampie Debut Document: Tall SSS Style Insurance Lady - Yuno Kamikari

  • yuno kamikari censoredcreampiesingle workPKPDfuck group and fun friends daydreamersPKPD-154PKPD154pkpd00154
    • 2021-07-07
    63 min

    FC2PPV 1909531 ☆ First shot ☆ Complete appearance ☆ Fair-skinned mochi skin de M beautiful girl ♥ When the switch is turned on even though it is quiet, "No! ♪ I’ve done it until the second round ♥ [Individual

  • amateur uncensoredfc2
    • 2021-07-13
    58 min

    499NDH-025 [Kinshicho’s reflex signboard girl. ] I thought that it was a calm and calm girl with a cute voice, but I picked up a huge breasts de M erotic signboard girl who likes to have sex intensely [Rumor! Tokyo signboard girl. 4th person]

  • amateur censoredbig titsamateurndhndh-025ndh025499ndh-025
    • 2021-08-04
    55 min

    10musume 080521_01 Cute Costume: Got A Maid With A Perfect Score Of 100 Shouko Takeda

  • amateur uncensored10musume
    • 2021-09-10
    68 min

    FC2PPV 2186488 A Beautiful Slender Who Works At A Bank Counter For The Second Year As A Member Of Society. A Large Amount Of Joy Juice Spills After Tearing Her Black Stockings. She Has A Large Amount Of Squirting, A Shameful Expression, And A Large A

  • amateur uncensoredfc2
    • 2021-09-17
    75 min

    299EWDX-378 Cum Inside Involuntarily To A Big Tits Baby Face Wife With A Cute Smile!

  • amateur censoredcreampiebig titsewdxewdx-378ewdx378299ewdx-378
    • 2021-10-29
    195 min

    [MIDE-989]Of Course It"s Embarrassing, But It"s Time For Some Hardcore Sex Training! Nothing But First Experiences! A Sensuality-Awakening 3-Fuck Special Mio Ishikawa

  • ishikawa mio censoredblowjobbeautiful girlMIDEmoodyzusapyonmoodyz divaMIDE-989MIDE989mide00989
    • 2021-11-05
    85 min

    FC2PPV 2404542 CP0138 Cowgirl Super Horse Prickets Gal 2nd! Rich Creampie In Uniform Costume Misa ❤ Shaved ❤ Uncut ❤ Oni Close-Up ❤ Subjective ❤ Super High Quality ❤ 4k60fps ❤

  • amateur uncensoredfc2
    • 2021-11-16
    138 min

    [TEN-038]Yukemuri NAWA-KOKOKU 1 Rei Kurugi

  • satoshi kuruki censoredbdsmsingle workTENvan associatestenma harutenmaTEN-038TEN038h-859ten00038
    • 2021-11-16
    66 min

    C0930 ki211116 Shinobu Kawahara 28years old

  • amateur uncensoredc0930
    • 2021-11-18
    76 min

    [REBD-602]Asuna5 Hello, Sexy Party! - Asuna Kawai

  • asuna kawai censoredsingle workREBDrebeccachikara sawamuraREBD-602REBD602h-346rebd00602
    • 2021-11-20
    242 min

    [NASH-604]A Mature Woman"s Lesbian Kisses 3

  • sakisui arima karen censoredlesbianmature womanNASHnadeshikojun nagasawaNASH-604NASH604nash00604
    • 2021-12-03
    133 min

    [NNPJ-481]Pickup of KBG Gal With Goddess Tits on the Beach in Enoshima. "It"s A Safe Day So Creampie Is Fine". So Fucked Up She Cums Again And Again. Koko

  • censoredcreampiebig titsNNPJnampa japanNNPJ-481NNPJ481nnpj00481
    • 2022-01-14
    171 min

    [MIFD-193]She Came Here To Lick Men"s Anus! Kansai"s Prestigious Young Lady University S*****t, A Gem Of A Pervert, AV DEBUT! Anka Suzune

  • suzune anka censoredanalcreampieMIFDmoodyzmametaro mamezawamoodyz freshMIFD-193MIFD193mifd00193
    • 2022-01-15
    162 min

    [MMYM-052]Dirty Talking Obscene Woman Alice Otosu"s Plump And Round Thighs And Big Breasts Get Rubbed And Licked

  • otsu alice censoredbig titsslutMMYMmarrionyumeno aidayumenoMMYM-052MMYM052mmym00052
    • 2022-01-22
    241 min

    [HMIX-008]The Overflowing Sexual Desire Of Mature Women In Their 60"s. The Greedy Desire For Pleasure That Has Increased With Age! Sixty Years Old Women"s Intimate Intercourse 20 People 4 Hours

  • michiko uchihara emi toda censoredmature womanmomHMIXglobal media entertainmenthyper mix global media entertainmentHMIX-008HMIX008hmix00008
    • 2022-01-24
    79 min

    345SIMM-691 [After-School Compensated Dating] [Big Breasts Uniform Girl] First Compensated Dating For Boys Who Like Baseball Club Female Mane #Uniform #Big Breasts #Beautiful Breasts #Beautiful Big Butt #Shaved #Sujiman [Wame-Chan / Mei (18) / ＃ 003]

  • amateur censoredcreampiebig titssimmsimm-691simm691345simm-691
    • 2022-01-25
    120 min

    [SAN-037]Misa Katase, A Wife Who Goes To A Happening Bar Without Telling Her Husband, Ends Up Playing With Fire.

  • misa katase censoredbig titssingle workSANmotherkabin kizakuramother motherSAN-037SAN037h-796san00037



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi