mother law mature woma censored big tit high visio




FC2SSISMIDENGODHZGDWANZCAWDATIDNATRMIAAGVHLULUAVSAHMNWAAAFSDSSDTTNACRMILKSHKDGMEM

2021-01-09
151 min

[IPX-603]Airi Kijima Untarnished Sex, For Real "If I Get A Boyfriend For The First Time In 10 Years, This Is The Kind Of Sex I Want To Have" That's How This Idea Started No Script, No Direction... This Is Simply A Private Video Of Her, Fi

  • airi kijima censoredblowjobsingle workIPXidea pocketmichiru arashiyamadishIPX-603IPX603ipx00603
    • 2021-01-24
    78 min

    299EWDX-346 Eyes nailed! I want to bring in my G-cup loli wife somehow!

  • amateur censoredcreampiebig titsewdxewdx-346ewdx346299ewdx-346
    • 2021-02-06
    182 min

    [NKKD-195]Car Camera Cheating 17 - The Drive Recorder Catches Everything

  • censoredmature womanNKKDjet eizomanji groupNKKD-195NKKD195nkkd00195
    • 2021-02-11
    67 min

    H0930 ki210211 Yukina Matsumoto 33years old

  • amateur uncensoredh0930
    • 2021-02-15
    42 min

    FC2PPV 1687887 [No] #Big breasts black hair maid. Gonzo diary only for two people.

  • amateur uncensoredfc2
    • 2021-02-19
    66 min

    [opcyn-155]ゆきの 2(21)

  • amateur censoredbig titsamateuropcynopcyn-155opcyn155opcyn-155
    • 2021-02-21
    120 min

    [OBA-412]Are You Happy Doing It With Such An Older Woman...？ Having An Enthusiastic Affair With A Younger Man In Her Workpalce - Miya Tanaka

  • miya tanaka censoredbig titsmature womanOBAmadonnavivaobasanOBA-412OBA412oba00412
    • 2021-03-01
    120 min

    [EMOT-015]Newlywed Life With Rin Kira To Enjoy In Full POV

  • kira rin censoredcreampiesingle workEMOTplanetdirector oemotionEMOT-015EMOT015h-237emot00015
    • 2021-03-03
    46 min

    362SCOH-044 [Creampie] Let a carefully selected beautiful girl cosplay and conceive my child! [Pi ● Kio]

  • amateur censoredcreampieamateurscohscoh-044scoh044362scoh-044
    • 2021-03-05
    84 min

    [DOKI-018]Sweaty! Non-nude Erotica!/Non

  • amateur censoredDOKIorustak softDOKI-018DOKI018
    • 2021-03-05
    41 min

    416SVMM-046 Nene

  • amateur censoredcreampiesquirtingsvmmsvmm-046svmm046416svmm-046
    • 2021-03-09
    132 min

    [SDJS-111]- What If You Were The Only One Naked At Work - Could You Still Do Your Job？ We Find Out From The Interns At SOD - Our Female Employees Attempt The Ultimate Experience In Embarrassment! Try Working For One Day In The Nude, And You're Hi

  • censoredbig titsamateurSDJSsod createchain sousod female employeeSDJS-111SDJS1111sdjs00111
    • 2021-03-17
    62 min

    492MERC-280 Gal Who Wants To Be A Wife

  • amateur censoredcreampieuniformmercmerc-280merc280492merc-280
    • 2021-03-20
    60 min

    10musume 032021_01 Amateur girl addicted to kinky sex with middle-aged man Kazumi Okada

  • amateur uncensored10musume
    • 2021-04-03
    62 min

    10musume 040321_01 The Structure Of Woman : There is a slight fever in the vagina due to the friction of the dick Yu Nagata

  • amateur uncensored10musume
    • 2021-04-10
    138 min

    [EKDV-658]My Stepsister Took My Virginity... My Sweet Stepsister Offered To Teach Me How To Have Sex After I Got My First Girlfriend Asuka Momose

  • momose asuka censoredcreampiesisterEKDVcrystal eizoharuo miyafujie kissEKDV-658EKDV658ekdv00658
    • 2021-04-22
    115 min

    [FSDSS-209]Lust, Instinct, The Feeling Of Pussy

  • there is hashimoto censoredsingle workFSDSSfalenoyamaguchi memberfaleno starFSDSS-209FSDSS2091fsdss00209
    • 2021-04-26
    90 min

    FC2PPV 1787200 [Individual shooting 37] Complete appearance 20 years old Legal Lori Paipan Serika ③ 2 Reinjection after continuous vaginal cum shot

  • amateur uncensoredfc2
    • 2021-05-01
    180 min

    [JUL-565]Married Woman With A Hand So SK**led It Could Be Considered A Weapon Takako Izumi 36 Years Old Works At A Famous Cosmetics Shop Porn Debut

  • takako izumi censoredbig titsmature womanJULmadonnakannana dainanaJUL-565JUL565jul00565
    • 2021-05-07
    237 min

    [MUCD-247]Akari Mitani 4 Hours Super Best Of Collection To Enjoy "Akarin" For 240 Whole Minutes Permanent Download Version

  • mitani akari censoredcreampiecosplayMUCDmukuMUCD-247MUCD247mucd00247
    • 2021-06-03
    116 min

    [AKDL-115]Becoming A Sexual Prey At My New Job, The Whole Department Together

  • karen asahina yura marino censoredbig titsdramaAKDLaquinoriaquinoriaknrAKDL-115AKDL1151akdl00115
    • 2021-06-16
    160 min

    [DVDMS-678]A Normal Boys And Girls Focus Group Adult Video We Followed Up On A Stepmother And Her Stepson To See What Happened In This Special On The Other Side Of That One-Way Mirror Is His Newly Married Dad! This Cherry Boy Stepson And His Big Tits

  • censoredcreampiebig titsDVDMSdeep shikaru kamegashiraDVDMS-678DVDMS678dvdms00678
    • 2021-06-28
    61 min

    328HMDN-377 [9 Head Body] Insta Newlyweds Akagachi Model Mom Cuckold 25 Years Old And Seed With A Large Sperm! I caught it with a model of Mama’s swimsuit and doubled the sensitivity with calling oil. Acme who is completely fallen by being fucke

  • amateur censoredcreampiemarried womanhmdnhmdn-377hmdn377328hmdn-377
    • 2021-06-30
    103 min

    435MFC-119 [S-type big butt Shinmama who blames the younger man] Kansai dialect quarter Beautiful mom can not show it to her daughter! Cinderella time from "mother" to "woman" ♪ Sucking a young cock with a nasty tongue out blowjob, sw

  • amateur censoredcreampieamateurmfcmfc-119mfc119435mfc-119
    • 2021-07-03
    110 min

    [MGMJ-050]Pantyhose Beautiful Legs Kitchen - Rei Aino

  • aino rei sena asami censoredslutsingle workMGMJmegamibeautiful goddess fetishMGMJ-050MGMJ050mgmj00050
    • 2021-07-17
    100 min

    355OPCYN-167 Madoka Shizuki Madoka

  • amateur censoredcreampiebig titsopcynopcyn-167opcyn167355opcyn-167
    • 2021-07-23
    160 min

    [LULU-083]I Took Advantage Of The Gorgeous Madonna Who Peed Herself At The Class Reunion After Party And Made Her Into My Married Sex Pet! Runa Tsukino

  • tsukino luna censoredcreampiesingle workLULUlunaticsvagmanLULU-083LULU083lulu00083
    • 2021-07-30
    117 min

    [RBK-021]I Get Fucked Every Day By My Mom"s New Husband. Sora Minamino

  • minano sora censoredbeautiful girlsingle workRBKattackerskitorune kawaguchiryuu bakuRBK-021RBK021rbk00021
    • 2021-07-30
    78 min

    259LUXU-1453 Luxury TV 1437 Often Not Satisfied With Sex … Such A Beautiful Manager Appears In AV In Search Of The Best Sex. I Feel Trembling With A Rich Caress And Accept The Phallus With A Fascinating Face …!

  • amateur censoredbig titsamateurluxuluxu-1453luxu1453259luxu-1453
    • 2021-08-11
    55 min

    C0930 ki210814 Yuko Arakawa 38years old

  • amateur uncensoredc0930
    • 2021-08-13
    173 min

    [SKMJ-194]I"m Going On A Harlem Hot Spring Resort Vacation With 6 College Girl Babes, And I"m The Only Guy! After A Seven-Way Large Orgies Fuck Fest In The Outdoor Bath And Cumming Like Crazy, These Horny JDs Were Still Not Satisfied, And The

  • censoredbig titsbeautiful girlSKMJsekimenjoshinagase swingsekimen goshiSKMJ-194SKMJ194h-1324skmj00194
    • 2021-08-14
    122 min

    [CHCH-009]A Hunter Who Likes Chubby Girls Leaks Videos Of A Married Woman Who Has Colossal Tits And Who Excited Him The Most In The Past. Akana (38-Years-Old/H-Cup)

  • censoredbig titsamateurCHCHchichi to haha emmanielchichi to hahaCHCH-009CHCH009chch00009
    • 2021-08-14
    132 min

    [MKON-059]The Tale Of How My C***dhood Friend That Had Promised To Marry Was Fucked By Some Random Private Tutor That Came From Nowhere. Urara Kanon

  • hanaoto urara censoredcreampiesingle workMKONkaguya hime pt mousozokuyumesaki ichiroumikonMKON-059MKON059mkon00059
    • 2021-08-28
    57 min

    H4610 tk0041 Aki Osagawa 20years old

  • amateur uncensoredh4610
    • 2021-08-30
    51 min

    292MY-465 Kaneko hitona 1

  • amateur censoredbig titsmarried womanmymy-465my465292my-465
    • 2021-09-02
    63 min

    FC2PPV 2131775 [5980 → Limited Number 2980] Active K High Teacher ❤️ First And Last Secret Gonzo ❤️ Plenty Of Active Teacher Blowjob ❤️ Pile Driving Cowgirl With Crab Crotch Led By Teacher ❤️ Vaginal Iki ❤️ Nipple Iki ❤️ Simultaneous Vaginal Cum Shot

  • amateur uncensoredfc2
    • 2021-09-03
    134 min

    [JJCC-008]The Unfaithful Wife Who Wants Some Sperm, JJCC- 008

  • censoredcreampiebig titsJJCCjuku onna japan emmanuellejuku onna japanJJCC-008JJCC008jjcc00008
    • 2021-09-18
    20 min

    FC2PPV 2217427 Forced Without Blow Job In The Car 3 Consecutive Mass Cum Shot ☆ Female College Student Hostess Ai-Chan 21 Years Old

  • amateur uncensoredfc2
    • 2021-10-01
    87 min

    483SGK-045 [Hidden Metamorphosis Female College Student] [Bristles Bicha Man] [Geki Kawamusume With Announcer Face] [Sensitivity Abnormal] A Female College Student With An Insanely Cute Announcer Face … Is It Okay To Do Something Strange？ Of Cou

  • amateur censoredamateurbeautiful girlsgksgk-045sgk045483sgk-045
    • 2021-10-05
    64 min

    200GANA-2570 In The Spear Room Of The Nampa Master Of 100 Battles, Bring In Sex Hidden Shooting 220 "I Can Make Cotton Candy! ] And Sex With A Nice Ass Gal Brought Home! "Do More !!!!" Voyeur The Appearance Of Being Disturbed By A Fierce

  • amateur censoredamateurganagana-2570gana2570200gana-2570
    • 2021-10-07
    190 min

    [STARS-437]ローレン花恋 AV DEBUT

  • lauren hanako censoredsoloworkSTARSsod createkomatsu 17sod starSTARS-437STARS437
    • 2021-10-07
    183 min

    [SVDVD-882]Betrayed And Taken Advantage Of! Naive S********l From An All Girls School! Better Call Your Friends If You Don"t Want A Creampie! The S*****ts Take Over The Class To Get Back With Endless Fucking And Creampie Loads! 10 Cum Loads Total

  • kusumi mikako horiuchi censoredcreampiesquirtingSVDVDsadistic villageistkanmusumeSVDVD-882SVDVD8821svdvd00882
    • 2021-10-09
    121 min

    [BACN-038]Mister, You"re Coming By Again After School, Right？ Ai Kawana

  • ai kawana censoredcreampiesingle workBACNbarutanyuuseicandyBACN-038BACN038bacn00038
    • 2021-10-09
    120 min

    [BAHP-089]Excuse Me Miss, May I Fuck You？ Nacchan Is A 20-Year Old, A Cheerful And Bright Maid Who Works At An Inn She Made Her Adult Video Debut But Only If She Was Allowed To Wear Masks!

  • censoredBAHPbarutanyo sukehoppinBAHP-089BAHP089bahp00089
    • 2021-10-16
    123 min

    [ZOCM-009]She Was My Honor S*****t ... And She Hit Me With Reverse NTR. A Brilliant Girl With A Standard Deviation Score Of Over 70 Mao-chan Mao Watanabe

  • mao watanabe censoredcreampieuniformZOCMzokuzoku musume mousouzokutodozokuzoku musumeZOCM-009ZOCM009zocm00009
    • 2021-10-21
    55 min

    SIRO-4672 [First Shot] [Small Animal Girl] [Young Beautiful Skin] A Cosmetology Student With A Friendly And Lovely Smile. With The Rushing Pleasure, Gradually Change The Smile To A Screaming Face And Announce The Climax Many Times With A High-Pitched

  • amateur censoredamateursirosiro-4672siro4672siro-4672
    • 2021-10-22
    320 min

    [HUNTB-120]Things Get Lewd Right From The Start! Super Slutty Step-sister Moves Into Guest House With Just Me Here Alone. Now I"m Hard 24 Hours A Day, 365 Days A Year For Lewd Fun!

  • censoredcreampieHUNTBhuntervolvo nakanohhh groupHUNTB-120HUNTB120huntb00120
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-04
    57 min

    FCP-050 [Delivery Only] Gal Slut Ejaculation Management! "Isn’T It Still Cool？ Small Fish Chi ● Po! !! ♯1 (Reira Kuon Horikita Wan Horikita Ria)

  • amateur censoredamateurslutfcpfcp-050fcp050fcp-050
    • 2021-11-17
    106 min

    420HOI-171 Ayume (Hanamiya Amu)

  • amateur censoredbig titsamateurhoihoi-171hoi171420hoi-171
    • 2021-11-26
    69 min

    [HEYZO-2671]Manami Shaved Pussy Gal Gets Fucked At Interview

  • manami uncensoredheyzo
    • 2021-12-03
    141 min

    [HEYZO-2688]tong jenny waan Sex in Asia ＃Tong ＃Jenny ＃Waan

  • amateur uncensoredheyzo
    • 2022-01-01
    63 min

    230OREC-981 Azumi (Azusa Misaki)

  • amateur censoredamateurbeautiful girlorecorec-981orec981230orec-981
    • 2022-01-15
    61 min

    H4610 ori1771 Chiaki Komiyama 21years old

  • amateur uncensoredh4610
    • 2022-02-02
    138 min

    300MIUM-783 [G Milk 4sex] Reiwa Revive To Wake Up! (Dwelling Invasion) Big Breasts Ol Completely Fell Into The Hands Of The Underwear Mud That Is Approaching Regardless Of Work Or Lunch Break! (Aika Natsume)

  • amateur censoredbig titssquirtingmiummium-783mium783300mium-783
    • 2022-02-08
    487 min

    [KTRA-381]Small Tits & Shaved Pussies! A Commemorative Featuring A Beautiful Girl Who Is My Younger Stepsister. Compilation of 4 Girls. 8 Hours. Box Set Of 4 DVDs.

  • hinako tsukishima haruka censoredcreampieKTRAk tribeKTRA-381KTRA381h-094ktra00381



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi