nine 031




FC2VENXSTARSJULAUKGMIAAMVSDSPRDAVSAMIDENACRCAWDCESDRBDDASDNATRATIDDTTJUFEMILKSSIS

2020-11-21
49 min

FC2PPV 1577862 [A lot of benefits] If you try to have a junior who was a virgin until a while ago and a locally famous gal bitch alone … You will have sex insanely (laugh)

  • amateur uncensoredfc2
    • 2020-11-23
    62 min

    FC2PPV 1581043 [First-run limited 1980] Restructuring a certain hard profession Sister ❤️ Cut down your savings and remove the squirrel ❤️ No inside! Out! It is said that I go out live … Unauthorized vaginal cum shot from! ❤️ * There are review

  • amateur uncensoredfc2
    • 2020-11-23
    146 min

    [AGAV-039]Totally Caught On Tape At Home! Experiencing Living Together With Saki Misami Is Too Obscene And Will Make You Want To Marry Her - Saki Misami

  • saki mizumi censoredblowjobsingle workAGAVsex agent daydreamersdaibutsu yoshidasex agentAGAV-039AGAV039agav00039
    • 2020-11-27
    251 min

    [KNMD-098]The Hidden Face Of A Good Wife And Wise Mother... Family Fun, A Wife Willing To Devour Her Stepson's Cock - 4 Hours

  • namiki touko amami bookmark censoredcreampiemature womanKNMDkinemamanjiroKNMD-098KNMD098h-1352knmd00098
    • 2020-12-02
    59 min

    326HGP-006 [Back customs] G cup young wife who has runaway libido begs for vaginal cum shot! Raw insertion from a roaring blow job ⇒ with a delivery health bite secret to her husband! !! With a very beautiful flesh body that everyone will fall in lov

  • amateur censoredcreampiebig titshgphgp-006hgp006326hgp-006
    • 2020-12-07
    53 min

    FC2PPV 1594592 [Personal shooting] [No] First shot Gachinko compensated dating girl! The third! Challenge with a wig for NG! 153cm small ass B cup slender Momo-chan with review benefits, high-quality ZIP, blowjob and masturbation (49 minutes)

  • amateur uncensoredfc2
    • 2020-12-10
    63 min

    413INST-077 Tomomi-chan, 21 years old ☆ Chi ● A devil’s rotor three-point blame on a milk dollar BODY that makes you squeeze ♪ Bikubiku cum man juice betting! G-spot Goryu Egg and serious soup dripping seeding complete agreement Peace sign ♪ Mou

  • amateur censoredcreampiebig titsinstinst-077inst077413inst-077
    • 2020-12-21
    80 min

    259LUXU-1362 Luxury TV 1342 A beautiful dancer who decided to appear on AV to have memorable sex before getting married! Don’t miss the gorgeous and lustrous appearance of a Latin half-beautiful woman who is tired of having sex that is too ordin

  • amateur censoredbig titsamateurluxuluxu-1362luxu1362259luxu-1362
    • 2021-01-01
    158 min

    [TSF-011]College Guy Wakes Up As A Girl (20) - Normally He Loves Comics For Girls, Now It's His Turn To Get Fucked As A Woman Jin Ichinose

  • ichinose jun censoredcreampiebig titsTSFkaguyahimept mousouzokugynecomastia reportTSF-011TSF011tsf00011
    • 2021-01-03
    70 min

    FC2PPV 1630371 2021 ★ Azusa ★ Foul-class finest Lori ★ Erotic girl with pure anime voice ★ Young. Transcendence recommended ★ With bonus video that is too erotic for the first time

  • amateur uncensoredfc2
    • 2021-01-04
    84 min

    Pacopacomama 010421_412 Ayano Honjo

  • ayano honjo uncensoredcreampieblowjobpacopacomama
    • 2021-01-22
    482 min

    [KPB-014]An Absoutely Sure Thing Beautiful Slut Adult Video Maker KANBi Best Hits Collection 8 HOurs Vol.3 6 First Time Shots Debut Videos Featuring Beautiful Married Woman Babes That Made History In This Super Select Collection!!

  • airi takasaka mina hasegawa censoredcreampiebig titsKPBprestigekanbiKPB-014KPB014118kpb00014
    • 2021-01-29
    42 min

    [moj-006]おとは

  • amateur censoredcreampiebig titsmojmoj-006moj006moj-006
    • 2021-01-30
    61 min

    Caribbeancom 013021-001 Special Boobs SEX For Boobs Fetish Airi Mikumo

  • airi mikumo uncensoredcreampiehandjobcaribbeancom
    • 2021-02-01
    96 min

    [KCK-009]Pet Traps 9, Hottie Cock Pet Plaything, Kyoko

  • censoredbdsmKCKsanwa publishingclick manKCK-009KCK009h-019kck00009
    • 2021-02-06
    143 min

    [NGOD-143]Please Promote My Husband... In Return, I'll Let You Touch My Tits... Chitose Yuki

  • chitose in the evening censoredmature womansingle workNGODjet eizomanji groupNGOD-143NGOD143ngod00143
    • 2021-02-06
    480 min

    [HHAP-008]Women Who Get Fucked By Intruders In Their Homes And Give Up Resisting: BEST

  • censoredHHAPapachehhh groupHHAP-008HHAP008hhap00008
    • 2021-02-07
    239 min

    [YLWN-153]Horny Mature Nurses At A General Hospital! If You Hit On Them, Will They Fuck You？

  • censoreduniformmature womanYLWNyellow moonpappan tateishiYLWN-153YLWN153ylwn00153
    • 2021-02-10
    31 min

    FC2PPV 1680576 Limited to 3 days [Individual] In order to collect a large amount of debt, I rushed to the house and made another stick sucked in the mouth and drooled and made a large amount of vaginal cum shot

  • amateur uncensoredfc2
    • 2021-02-19
    123 min

    [BKD-257]Stepmom/Stepson (The Road To Western Nikko) Nao Nakano

  • nanao nakano censoredcreampiemature womanBKDrubyshakojijourneyBKD-257BKD257bkd00257
    • 2021-02-22
    59 min

    501TNT-002 Ren 2

  • amateur censoredamateurtnttnt-002tnt002501tnt-002
    • 2021-02-25
    106 min

    [SPRD-1382]I Creampied My Boss's Mom - Yurie Miyata

  • yurie miyata censoredmature womanmomSPRDtakara eizokyuta tukumoaleddinSPRD-1382SPRD138218sprd01382
    • 2021-03-01
    70 min

    488MCV-011 Athletes’ SEX was erotic in another dimension

  • amateur censoredcreampiebig titsmcvmcv-011mcv011488mcv-011
    • 2021-03-11
    82 min

    AVKH-194 Sonoda Airi

  • amateur censoredcreampieamateuravkhavkh-194avkh194avkh-194
    • 2021-03-17
    130 min

    [pow-044]ひよたん

  • amateur censoredbig titsamateurpowpow-044pow044pow-044
    • 2021-03-30
    72 min

    300NTK-544 [Beautiful Big Tits SEX Specialized Beauty With Tall H Cup! !! ] Because it is such a time, drinking at home is the best! !! Self-restraint and drinking sexual intercourse alone at home (studio ww) with huge breasts beauty that becomes ero

  • amateur censoredcreampiebig titsntkntk-544ntk544300ntk-544
    • 2021-04-02
    122 min

    [PRED-303]Hard Nipples Older Woman Gets Creampied For The First Time Ever Mami Sakurai

  • mami sakurai censoredcreampiesingle workPREDpremiumsuisei akaielegancePRED-303PRED303pred00303
    • 2021-04-20
    120 min

    [SPZ-1101]Money Shots: Blowjob Loads Blown In Mouths And Handjobs With Freshly Stripped Pantyhose 8 Girls

  • censoredblowjobhandjobSPZstar paradisestar paradiesSPZ-1101SPZ1101h-254spz01101
    • 2021-04-22
    115 min

    [FSDSS-209]Lust, Instinct, The Feeling Of Pussy

  • there is hashimoto censoredsingle workFSDSSfalenoyamaguchi memberfaleno starFSDSS-209FSDSS2091fsdss00209
    • 2021-04-24
    71 min

    300NTK-558 A miracle combination! ？？ Orthodox beautiful girl x hikikomori x transcendental style = superb P activity experience! !! Hikikomori’s libido is incomplete! !! Let’s take a look at the complete foolery of a beautiful girl who spri

  • amateur censoredcreampieamateurntkntk-558ntk558300ntk-558
    • 2021-05-11
    125 min

    [KIRE-038]It Appears You Know How To Have Normal Sex, But You Have No Idea What The Greatest Way To Fuck Is ... This Older Lady Will Hit You With Dirty Talk And Shake Her Ass With A Piston-Pounding Cowgirl And Wiggle And Jiggle Her Ass Until She Milk

  • minami kozue censoredcreampiesingle workKIREsod createmiyoshi rusherbeauty kirei sodKIRE-038KIRE0381kire00038
    • 2021-05-15
    131 min

    [EVIS-352]Wet And Wild Lesbians Gargling And Gulping Down Huge Amounts Of Spit And Saliva

  • sumire seto yuka saeki censoredlesbianslutEVISebisusan mousouzokubyakkoEVIS-352EVIS352evis00352
    • 2021-06-04
    138 min

    [JUL-606]Only For Me! Married Creampie Maid Has To Do Whatever She's Told Total Obedience To Her Step Uncle's Orders Days Spent Being Trained And Fucked Hijiri Maihara

  • kiyoshi maihara censoredcreampiemature womanJULmadonnarokusaburo mishimaJUL-606JUL606jul00606
    • 2021-06-10
    159 min

    [MIST-339]On The Unsafe Day!! Creampie Soapland 29 Kururugi Aoi

  • aoi kururugi censoredcreampiesingle workMISTmr michirusaitaMIST-339MIST3391mist00339
    • 2021-06-16
    120 min

    [FOCS-003]A Sexually Aggressive Big Tits JD She Can No Longer Stand Being Deprived Of Sex By Her Boyfriend! She Loves To Give A Blowjob And She's Got A Bottomless Well Of Sexual Lust She Can Never Resist The Temptation To Have Sex, And Will Secre

  • censoredbig titsamateurFOCSabc mousouzokufocusFOCS-003FOCS003focs00003
    • 2021-07-18
    140 min

    [DBER-118]The Lusty Beast Hunting Club The Cruel Tantalizing Of A Limber-Limbed Sacrifice - A Bewitchingly Beautiful Girl Cums In Hell - Part 8: The Tears And Roars Of The Robustly Sweet Nectar Of A Flesh Fantasy Doll Nanami Ozora

  • nanami ozora censoredbdsmsingle workDBERbabyentertainmentkikubonred babeDBER-118DBER118dber00118
    • 2021-08-22
    68 min

    HEYZO 2596 Amateur Girls In School Uniforms Enjoy Lesbian Play – Asuka Uchiyama – Yu Nagata

  • asuka uchiyama yu nagata uncensoredheyzo
    • 2021-08-24
    154 min

    [STARS-419]I Shared A Room With A Rugby Team Member And Was Fucked By Him For Two Days And One Night In The Middle Of Summer Mio Mashiro

  • mio mashiro censoredbeautiful girlsingle workSTARSsod createakai suiseisod starSTARS-419STARS4191stars00419
    • 2021-09-03
    118 min

    [CAWD-280]Kawaii, Right？ The Most Perverted And Hard Kawaii Slut Special. Sora Hoshino

  • hoshino hoshiyoshi censoredcreampieslutCAWDkawaiitaiga kosakaiCAWD-280CAWD280cawd00280
    • 2021-09-06
    53 min

    292MY-496 Uehon Nozomi 2

  • amateur censoredcreampiemarried womanmymy-496my496292my-496
    • 2021-09-09
    159 min

    [SW-797]My Classmate First Love With Big Tits And My Female Teacher With A Big Ass Meet At The Class Reunion To Fuck! 10 Years Later She Is a Married Woman With A Curvy Ass And Tits, Now I"m Too Hard And She"s Working My Dick At The Store, Ho

  • censoredbig titsSWswitchyocchanswitch hibinoSW-797SW7971sw00797
    • 2021-09-09
    125 min

    [NEO-763]Gal Saliva Bullying Runa Shimotsuki

  • shimotsuki runa censoreddeepthroatsingle workNEOradixsakuraba kyuu kokoro otokoneo radixNEO-763NEO763433neo00763
    • 2021-09-19
    50 min

    523DHT-0296 38 Years Old Full-Time Housewife Mari-San, 38 Years Old, A Carnivorous Cheating Wife

  • amateur censoredbig titsmarried womandhtdht-0296dht0296523dht-0296
    • 2021-09-25
    131 min

    [HMGL-188]Shy Bodies, Black Sun Yumi Saeki

  • yuka saeki censoredmature womandeepthroatHMGLhmjmcompany matsmaglamourHMGL-188HMGL188h-172hmgl00188
    • 2021-09-27
    97 min

    FC2PPV 2257439 I Tried To Play Metamorphosis To The Weather Girl Class Tsun Tsun Girls

  • amateur uncensoredfc2
    • 2021-10-01
    157 min

    [CAWD-281]"I"ve Memorized 100 Digits Of Pi!" Cheerful Mood! Great Smile! She Can"t Figure Out If She Should Be A Teacher Or AV Actress! Smart Horny College Girl "Reina Mori" Stops By From The Science Department To Make Her AV

  • rena mori censoredbig titsbeautiful girlCAWDkawaiiarashiyama michiruCAWD-281CAWD281cawd00281
    • 2021-10-20
    53 min

    541AKYB-033 Hana (21) Such A Cute Girl! ？？ Gou Pubic Hair Girls Who Continue To The Buttocks! (Urara Kanon)

  • amateur censoredamateurbeautiful girlakybakyb-033akyb033541akyb-033
    • 2021-10-21
    125 min

    [STARS-450]ドS愛人の超絶上から見下しマウント騎乗位!ダメな男を罵ることで快感を得る激ヤバ痴女の密室射精管理 本庄鈴

  • honjou suzu censoredSTARSsod createdoragon nishikawasod starSTARS-450STARS450
    • 2021-10-22
    141 min

    [ROE-014]Beautiful, Kind, Sexy, The Ideal G Cups Boss. Working At A Major Apparel Brand. Rumi Amano 47 Years Old JAV DEBUT.

  • rumi amano censoredbig titsmature womanROEmadonnamamezawa mametaroumonroeROE-014ROE014roe00014
    • 2021-10-26
    130 min

    [SAN-025]The Tragic Story Of A Wife With Rippling Titties Who Went To A Domestic Issues Support Center For Help. Yuria Yoshine

  • yoshine yuria censoredbig titssingle workSANmazagod maramother mazaSAN-025SAN025h-796san00025
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-06
    122 min

    [CEMD-077]AV Document On D***king All Day With Rin Kira!

  • kira rin censoredcreampiemature womanCEMDserebu no tomoCEMD-077CEMD077cemd00077
    • 2021-11-09
    59 min

    [110921-001]Complaint Office Lady Apologize with the Body Vol.8 Cowgirl Dogeza! I"m sorry I"m the only one cum!

  • chiaki saeki uncensoredcreampiehandjobcaribbeancom
    • 2021-12-15
    95 min

    435MFC-167 [Beautiful Nursery Teacher, Shameful Sex By The Window From Midday! !! !! !! ] You May Be Able To See It From The Outside & The Excitement Is Max With The Camera For Gonzo! !! Over There Is Soaked ♪ Namanaka Ecchi For Uncontrollable Sex

  • amateur censoredcreampieamateurmfcmfc-167mfc167435mfc-167
    • 2021-12-23
    116 min

    [SPRD-1496]My Mother-in-law Is Even Better Than My Wife... Satomi Nagasawa

  • satomi nagasawa censoredmarried womanmature womanSPRDtakara videoscallop consistencyaleddinSPRD-1496SPRD149618sprd01496
    • 2021-12-27
    108 min

    300MIUM-771 [No.1 In This Term Immediately Iki Onicho Married Woman! !! ] Super Beautiful And God Style! Seriously Sss Class! !! If You Take It Around With A Remote Control, It Will Be Crazy Outdoors [Outrageous Metamorphosis Woman Kita Ww] Ji ● If Y

  • amateur censoredcreampiemarried womanmiummium-771mium771300mium-771



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi