other fetish high vision javcensored jav censored




FC2NACXHUNTBRBDNACRVEMABLKABWJUFEVENXLULUMILKNGODGMEMWAAADASDMIDESQTEMIDVGVHKSBJ

2020-05-16
165 min

[SSNI-780]She's Unwittingly Luring Men To Temptation With Her Clothed Big Tits A Super Lucky Horny Daydream Fantasy Situation Special Yua Mikami

  • yua mikami censoredbig titssingle workSSNIs1 no 1 styletake dSSNI-780SSNI780ssni00780
    • 2020-05-16
    118 min

    [SSNI-786]For Titty Lovers Only: The Ultimate 104cm Tits - Titty Fuck Maniacs - Mei Washio

  • mei washio censoredbig titssingle workSSNIs1 no 1 styletiger kosakaiSSNI-786SSNI786ssni00786
    • 2020-05-16
    161 min

    [DVDMS-543]This College Girl Is Living Alone, Prancing Around In Black Pantyhose, And I Couldn't Resist, So I Pumped My Big Cock Into Her From Behind For A Quickie! Then I Grabbed Her Ankles And Thrust Deep Into Her Pussy For Piston-Pounding Sex!

  • censoredcreampieamateurDVDMSdeep sswing nagaseDVDMS-543DVDMS543dvdms00543
    • 2020-05-15
    150 min

    [HGOT-036]I Discovered Her Fetish When We Started Living Together

  • blue shiiki walnut censoredcreampiesquirtingHGOTjohnny shibuyaHGOT-036HGOT036h-1414hgot00036
    • 2020-05-15
    90 min

    [SALO-015]Queen Saku's Breaking In Room Saku Kurosaki

  • saku kurosaki censoredsingle workSALOk m producesalomeSALO-015SALO01584salo00015
    • 2020-05-15
    87 min

    [SALO-016]Queen Maria's Breaking In Room Mari Wakatsuki

  • maria wakatsuki censoredsingle workSALOk m producesalomeSALO-016SALO01684salo00016
    • 2020-05-15
    168 min

    [NIKM-044]You've Been Waiting For This! A Furiously Fine Woman! A Divine Body! Exquisite Eroticism Lena Kannazuki

  • godless moon censoredbig titssingle workNIKMnikumoripiNIKM-044NIKM044h-1323nikm00044
    • 2020-05-15
    122 min

    [VRTM-500]This Big Tits Big Stepsister Is Worried About Her Cherry Boy Little Stepbrother, So She Decided To Take A Bath With Him! She's Using Her Voluptuous Titties To Hold On Tight To Her Excited Little Stepbrother And Give Him A Hot Body Washi

  • sachiko tsugumi morimoto censoredcreampiebig titsVRTMv r producegoro koenjiVRTM-500VRTM500h-910vrtm00500
    • 2020-05-15
    64 min

    [ETQR-133]2 Perverts With Complicated Sexual Hangups Go Head To Head Mitsuki Nagisa

  • scooping censoredcreampieuniformETQRerotic timeETQR-133ETQR133h-1186etqr00133
    • 2020-05-15
    118 min

    [XRW-873]Shaven S&M 05: Getting Her Crotch Shaved And Then Tied Up Completely Nude With Her Shaved Pussy On Display!

  • censoredXRWreal worksdylan wealth increasereal real worksXRW-873XRW873172xrw00873
    • 2020-05-14
    122 min

    [FGAN-016]The Panty Fetish Appreciation Society Ichika Ichika Kasagi

  • kasagi ichika censoredcreampiesingle workFGANfetish eyesFGAN-016FGAN016h-1440fgan00016
    • 2020-05-14
    124 min

    [FGAN-015]Creampie Bloomer Girls Tsugumi Tsugumi Mizusawa

  • tsugumi mizusawa censoredcreampiesingle workFGANfetish eyesFGAN-015FGAN015h-1440fgan00015
    • 2020-05-11
    53 min

    [EMOI-006]An Emotional Girl/Her 4th Video/Let's Lead A Fresh Face To Ecstasy/Rotating Bed/A Showa Love Hotel/A Couple, Born In The Heisei Era/Emi Suzukaze (23)

  • emi suzukaze censoredbeautiful girlsingle workEMOIsod createtiger kosakaiemotional girlEMOI-006EMOI0061emoi00006
    • 2020-05-10
    139 min

    [MIBB-002]Black Pantyhose Honor S*****t Ichika Matsumoto

  • ichika matsumoto censoredschoolgirlsingle workMIBBmiluMIBB-002MIBB002mibb00002
    • 2020-05-09
    232 min

    [HJMO-434]We Welcome Horny Married Woman Babes With Long Tongues! The Walls Are Covered With Cocks In This Room, And She's Taking The 10-Cock Lick And Suck Challenge!! She's Soaking Her Tongue In Semen And Giving Vacuum-Powered Blowjob Action

  • censoredcreampieblowjobHJMOhajime kikakuhajimeHJMO-434HJMO434hjmo00434
    • 2020-05-09
    148 min

    [JUFE-174]This Dirty Old Man Is Driving This Naive Barely Legal Babe Crazy With Desire As He Develops Her Sensual Side - Memories Of Breaking In Training, That Summer In The Country - Ichika Matsumoto

  • ichika matsumoto miyagi ryo censoredcreampieuniformJUFEfitchJUFE-174JUFE174jufe00174
    • 2020-05-08
    162 min

    [ARM-866]When My Cum Bucket Elder Sister Type Friends Make Me Cum, It's Like Having A Threesome, And It's Always A Thrill

  • satomi suzuki yuri shinomiya censoredblowjobslutARMaroma planninghamu oujiaromaARM-866ARM866arm00866
    • 2020-05-08
    94 min

    [OKP-059]Divine Pantyhose Rion Izumi We're Bringing You A Lolita Beautiful Girl In A School Uniform With Beautiful Legs Wrapped In Naughty And Nasty Pantyhose For Fully Clothed Musty Sniffing Pleasure, From Her Soles To Her Toes! Enjoy Masturbati

  • rion izumi censoredmature womansingle workOKPdaddy s private photosgoro koenjigodly pantyhoseOKP-059OKP0591okp00059
    • 2020-05-08
    93 min

    [OKB-087]A Voluptuous Big Ass A Goddess In Bloomers Hana Torigoe From A Lolita Beautiful Girl, To A Chubby Girl, We Dressed These Hot Bitches In Tight Bloomers And Gym Shorts So We Could See Their Asses And Cameltoes Bulging Out So Hard Their Pussy H

  • hana torigoe censoredschoolgirlsingle workOKBdaddy s private photosgoddess in bloomersOKB-087OKB0871okb00087
    • 2020-05-08
    123 min

    [GNAB-021]My Friend's Wife Is Luring Me To Temptation With Her Erotic Ass, Bulging Out Of Her Hot Pants...

  • censoredGNABprestigebang prestigeGNAB-021GNAB021118gnab00021
    • 2020-05-08
    120 min

    [NEO-726]A Horny Daddy Goes Face-Licking Ann Sasakura

  • an sasakura censoredsingle workNEOradixshio sakurabaneo paradoxNEO-726NEO726433neo00726
    • 2020-05-08
    124 min

    [NEO-380]Get A Good Look At Her Pissing Masturbation At The Edge Of Her Panties

  • an sasakura mari takasugi censoredlingerieNEOradixneo paradoxNEO-380NEO380433neo00380
    • 2020-05-08
    93 min

    [OKZ-001]A Divine Mature Woman A Fifty-Something Lady Who Hasn't Been Fucked In Ages Momoko 50 Years Old She's Working A Secret Sexy Part-Time Job And The Last Time She Got Fucked Was Years Ago. This Married Woman Is About To Explode With Lus

  • shoko ueki censoredcreampiemature womanOKZdaddy s private photosgodly mature womanOKZ-001OKZ0011okz00001
    • 2020-05-08
    120 min

    [NEO-724]Bashful Armpits Misuzu Kawana

  • misuzu kawana censoredsingle workNEOradixlegend mukaineo paradoxNEO-724NEO724433neo00724
    • 2020-05-08
    87 min

    [RCTS-015]The Daydream Fantasy Item Ultimate Evolution Series The Dark Side Of Female Skin 2 - Evil Hot Plays With Cursed Skin -

  • aoi kururugi blue censoredlesbianRCTSrocketkiyoshi miwaRCTS-015RCTS0151rcts00015
    • 2020-05-08
    36 min

    [BTH-029]Hopeless Sex With An Honor S*****t With A Pregnancy Fetish Hikaru Minazuki

  • hikaru minazuki censoredcreampieschoolgirlBTHchobitchsuper bitchBTH-029BTH029h-1435bth00029
    • 2020-05-08
    124 min

    [GUN-686]THE TRANSSEXUAL BAR You Like Pre-Cum, Right？ Beatrix

  • beatrix censoredsingle workGUNradixlegend mukaibatsugun paradoxGUN-686GUN686433gun00686
    • 2020-05-07
    128 min

    [PORN-012]A Cock-Crazy Flesh Fantasy Slutty Lady Boss

  • censoredslutPORNcrystal eizomr pigporno zonePORN-012PORN01249porn00012
    • 2020-05-02
    161 min

    [DVDMS-537]Picking Up Amateur Girls - Office Ladies With Big Butts Get Fucked In Company Cars! - They Slack Off From Work And Get Raw Creampies In Their Wet Pussies! - 8 Cumshots

  • censoredcreampieamateurDVDMSdeep sswing nagaseDVDMS-537DVDMS537dvdms00537
    • 2020-05-02
    203 min

    [GDHH-198]"You're The Only One, Big Stepbrother, Who Thinks My Ass Is Nice." My Little Stepsister Has An Inferiority Complex About Her Excessively Big Ass... When She Became A S********l, Her Ass Continued To Grow And Grow...

  • censoredcreampiesisterGDHHgolden timekorosukehhh groupGDHH-198GDHH198gdhh00198
    • 2020-05-02
    240 min

    [HUNTA-767]"Hey, Do We Feel Gooood？？" My 2 Lady Bosses Are Sexual Monsters! When We Missed Our Last Train Home, My 2 Lady Bosses Decided To Get Together At My Place, When Suddenly, Things Took A Divine Turn!!

  • censoredcreampieHUNTAhuntervolvo nakanohhh groupHUNTA-767HUNTA767hunta00767
    • 2020-05-02
    121 min

    [ARM-863]Perforated Leather Pants SEX

  • kobayakawa reiko miku abe censoredblowjobARMaroma planningshigeo kadowakiaromaARM-863ARM863arm00863
    • 2020-05-01
    129 min

    [HDKA-208]Naked Housewife: Elly Akira, Arakawa City (30)

  • aki erie arai erie yuka osawa censoredcreampiebig titsHDKAplanet plusdirector orafu shukoHDKA-208HDKA208h-237hdka00208
    • 2020-05-01
    123 min

    [CLOT-011]The Temptation Of Pantyhose - Rio Yukino

  • yukino censoredcreampieblowjobCLOTplanet plusdirector ocloseCLOT-011CLOT011h-237clot00011
    • 2020-05-01
    122 min

    [UMD-733]I Was In The Hospital For So Long That I Got A Hard On Even For This Old Lady Nurse's See-Through Pants

  • nishimura arisa yurika censoredblowjobhandjobUMDleodragon nishikawaUMD-733UMD733125umd00733
    • 2020-05-01
    121 min

    [ONEZ-239]Thick Pussy Juices: Cowgirl Piston Fucking, 3cm From The Tip To Bottoming Out: Juicy Body Fluid PtoM Sex Act. 001: Riana Yuzuki

  • uzuki liana censoredcreampieblowjobONEZprestigetodoonezONEZ-239ONEZ239118onez00239
    • 2020-05-01
    301 min

    [DKSB-051]Filthy Sexual Harrasment Chiropractic Clinic Only Targets Beautiful Married Women 5 Hours

  • censoredbig titsamateurDKSBoffice k sno directork s bestDKSB-051DKSB05136dksb00051
    • 2020-05-01
    135 min

    [DOKS-517]These Women Don't Notice That Their Sensitive Nipples Are Being Stimulated Daily By An Invisible Man - They Must Wonder Why They're Always Turned On

  • baba kiriyama yuu censoredbig titsmature womanDOKSoffice k sfetchy oda fetchy oDOKS-517DOKS51736doks00517
    • 2020-05-01
    124 min

    [MARA-053]Hikaru Harukaze's Colossal Tits Theater! 92 cm G-Cup

  • spring breeze censoredcreampiebig titsMARAplanet plusdirector omarakasMARA-053MARA053h-237mara00053
    • 2020-05-01
    125 min

    [HDKA-207]Naked Home Care Workre - Aoi Mizutani

  • aoi mizutani censoredcreampieblowjobHDKAplanet plusdirector orafu shukoHDKA-207HDKA207h-237hdka00207
    • 2020-05-01
    144 min

    [DOKS-518]Thick And Super Steamy! Fleshy Pantyhose Kanna Shinozaki

  • kina shinozaki censoredsingle workDOKSoffice k sgonzaburo onigawaraDOKS-518DOKS51836doks00518
    • 2020-05-01
    124 min

    [HDKA-209]The Naked Maid: Nude Maid Agency: Hikaru Ikuno

  • hikaru ikuno censoredcreampiebig titsHDKAplanet plusdirector orafu shukoHDKA-209HDKA209h-237hdka00209
    • 2020-04-28
    164 min

    [EQ-515]Will You Squeeze My Big Tits？ Picking Up Local Amateurs With Big Tits!

  • censoredcreampiebig titsEQbullittrocket taropretty honey brittEQ-515EQ515h-100eq00515
    • 2020-04-28
    117 min

    [EQ-516]Old Ladies! Please Pump My Cock! Mature Woman Ladies Who Lust For Masturbating Men 8

  • censoredcreampiebig titsEQbullittshinobu kamezufetish specialtyEQ-516EQ516h-100eq00516
    • 2020-04-26
    160 min

    [LULU-018]"Ahhhh, What A Waste!" After A Pussy-Pounding Piston Cowgirl, He Flooded Her Pussy With His Young Semen, So She Gave Him A Nice Blowjob, And Then He Was Ready To Pump Her Cunt Again (Pussy To Mouth Sex)

  • censoredcreampieamateurLULUlunaticsvagmanLULU-018LULU018lulu00018
    • 2020-04-26
    167 min

    [MMKZ-076]A Chubby Girl With A Big Ass - Ena Koume

  • ena koume censoredsingle workMMKZmarrionkojiro miyamotoirisMMKZ-076MMKZ076mmkz00076
    • 2020-04-25
    150 min

    [MIFD-112]Working For The Knee High Socks Project Planning And Development Department Of A Famous Apparel Company! This Newly Graduated, Tall Girl Landed A Provisional Offer By Showing Off Her Total Domain, And Now Makes Her AV Debut Haruka

  • haruka censoredbeautiful girlsingle workMIFDmoodyzmon cmoodyz freshMIFD-112MIFD112mifd00112
    • 2020-04-25
    145 min

    [MIAA-270]This Pussy Shot Baring Teacher Is Flashing Pantyhose Without Her Panties On And Tempting You To Full Erection June Lovejoy

  • june lovejoy censoredslutsingle workMIAAmoodyzcaptain eharaeveryone s porn starMIAA-270MIAA270miaa00270
    • 2020-04-25
    147 min

    [WANZ-957]If You Come I Will Piston Fuck You Faster! Fucking A Maid With Plump Big Ass From Behind!! Kanon Kanade

  • kanon kanon censoredsingle workWANZones factorywanzWANZ-957WANZ957wanz00957
    • 2020-04-24
    240 min

    [OKAX-611]Vicariously Going On A Sexual Harrassment Attack Against Housewife Showing Off Her Butt And Tits: She's Not Screaming In Distress Though But Rather Letting Out Sweet Sighs Of Pleasure...

  • censoredamateurOKAXk m producedick mandokuokazuOKAX-611OKAX61184okax00611
    • 2020-04-24
    240 min

    [ABP-972]Hentai Samurai x Sakino Oto's Close Up Erotica 4 Hours Episode 3 See All Of Sakino Oto's Erotic Charms Dissected In Filthy Closeups

  • ototo sakino censoredcreampiecosplayABPprestigemasaru pantherabsolutely perfectABP-972ABP972118abp00972
    • 2020-04-24
    89 min

    [MBRBM-001]I Want To Go To Thailand And Hook Up With You! MIU SAKURAI

  • sakurai miu censoredsingle workMBRBMnctrno directorspice visualMBRBM-001MBRBM0015141mbrbm00001
    • 2020-04-23
    175 min

    [FSET-878]"If You Keep Rubbing Me Like That, I Won't Be Able To Resist!" A Thorough Pantyhose Cock Rubbing

  • akari shinmura mizuki hayakawa censoredFSETakinorino directoraknrFSET-878FSET8781fset00878
    • 2020-04-23
    93 min

    [OKB-086]A Voluptuous Big Ass A Goddess In Bloomers Aoi Mizutani From A Lolita Beautiful Girl, To A Chubby Girl, We Dressed These Hot Bitches In Tight Bloomers And Gym Shorts So We Could See Their Asses And Cameltoes Bulging Out So Hard Their Pussy H

  • aoi mizutani censoredschoolgirlsingle workOKBdaddy s private photosgoddess in bloomersOKB-086OKB0861okb00086
    • 2020-04-23
    94 min

    [OKP-058]Divine Pantyhose Chiharu Miyazawa We're Bringing You An Office Lady In Glasses Who Wears Business Suits With Her Beautiful Legs Wrapped In Naughty And Nasty Pantyhose For Fully Clothed Musty Sniffing Pleasure, From Her Soles To Her Toes!

  • chiharu miyazawa censoredsingle workbukkakeOKPdaddy s private photosgoro koenjigodly pantyhoseOKP-058OKP0581okp00058
    • 2020-04-23
    126 min

    [ZBDD-004]Ejaculation Control The Pull Out Gal This Beautiful Gal Wouldn't Let Me Ejaculate For A Month And Kept Teasing Me With Pull Out Shame Kana Igarashi

  • igarashi censoredsingle workZBDDjitsuroku shuppanrei kudoZBDD-004ZBDD004483zbdd00004



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi