roe




FC2ROYDGMEMNACRVENUJUFEABWHNDAVSAHDKANATRFSDSSVEMAGVHSPRDMVSDSHKDCESDHZGDJULAPOD

2021-01-01
61 min

FC2PPV 1627713 [Personal shooting] ♀ 268 Gravure Nono-chan 19 years old SP01 2020 Christmas special edition! A beautiful girl is conceived as a child seed juice gift (laughs)

  • amateur uncensoredfc2
    • 2021-01-04
    84 min

    Pacopacomama 010421_412 Ayano Honjo

  • ayano honjo uncensoredcreampieblowjobpacopacomama
    • 2021-01-05
    86 min

    300NTK-496 The tongue technique is amazing! !! Confrontation with the strongest professional daddy active daughter in western Japan of G cup P active girls! ？？ Raw chin sticks out with Gapuriyotsu! !! Compete with a wash-free blow job! !! I think tha

  • amateur censoredcreampiebig titsntkntk-496ntk496300ntk-496
    • 2021-01-23
    147 min

    [CAWD-171]She's The No.1 Men's Massage Parlor Girl And She's Horny And She's Got F-Cup Titties And A Tight Body And All She Does Is Give Men Nookie And Now She's Got Her Wish, A Big Horny Cock To Make Her Pant And Moan With Cum Cr

  • yu aoi aoi censoredsingle workCAWDkawaiijohan yuanCAWD-171CAWD171cawd00171
    • 2021-01-24
    131 min

    [ANZD-055]"I'm A Masochist..." By Day She's A Popular Beauty Parlor Professional, But The Truth Is She's A Cock-Craving Sub Who Wants To Get Pounded Aoi

  • censoredcreampieamateurANZDanzu daydream vacationanzuANZD-055ANZD055anzd00055
    • 2021-01-27
    245 min

    [MCST-005]Family Fun (MCST-005)

  • censoredcreampieMCSTmercurystrawberryMCST-005MCST005h-1133mcst00005
    • 2021-02-06
    51 min

    [HHKL-084]I Work At A Super Proper Relaxation Salon, And I Know It's Wrong, But The Truth Is, I'm A Horny Bitch Who Gets Excited When I Look At All The Male Customers. Mizuki Yayoi

  • mizuki yayoi censoredcreampieuniformHHKLhuntermorikihhh groupHHKL-084HHKL084hhkl00084
    • 2021-02-07
    239 min

    [YLWN-152]Horny Married Women Dripping Pussy Juice, Moaning Masturbation 19 Girls, 4 Hours

  • censoredamateurmature womanYLWNyellow moonpappan tateishiYLWN-152YLWN152ylwn00152
    • 2021-02-27
    244 min

    [MCSR-428]The Melancholoy Of A Beautiful Mature Woman In Mourning - Immoral Widow Babes - 5 Ladies 4 Hours

  • hitomi enjo yuki arai censoredmature womanMCSRbig morkalsaburo kamegashimamascottMCSR-428MCSR42857mcsr00428
    • 2021-03-09
    44 min

    302GERK-356 Chie (22)

  • amateur censoredcreampieamateurgerkgerk-356gerk356302gerk-356
    • 2021-03-11
    130 min

    [MEKO-206]All-New "The Old-Lady-For-Rent" Service 09 This Housecleaning Service Will Provide Everything, Even Creampie Sex, So I Decided To Make Some Even More Extreme Demands

  • censoredcreampieamateurMEKOmilf laboMEKO-206MEKO206h-1160meko00206
    • 2021-03-20
    102 min

    300MAAN-635 [Trauma-class brush wholesale experience! A lustful beauty makes a virgin a demon! ] Big breasts H cup sexually strong girlfriend (24 years old: working at a cosmetics company)! It’s designed by my boyfriend and I’m grateful! Di

  • amateur censoredcreampiebig titsmaanmaan-635maan635300maan-635
    • 2021-03-27
    105 min

    [VENX-021]"Do Old Lady Panties Excite You？ Older Woman Milks Young Man Of All Of His Cum With Her Worn Panties Sakura Tsukishima

  • tsukishima sakura censoredcreampiebig titsVENXvenussarufakecest winntersVENX-021VENX021venx00021
    • 2021-04-01
    103 min

    [AKDL-097](The Secret I Can Never Tell Anyone) My Father-In-Law Creampied Me Every Day My Husband Was Away For Work. Manami Oura

  • manami oura censoredcreampiebig titsAKDLaquinoristickaknrAKDL-097AKDL0971akdl00097
    • 2021-04-12
    90 min

    [DORI-018]Filming While Fucking No.18 This Big Tits Voluptuous Young J* Gal Will Let Him Slide It In Raw, And Then She Clamped His Dick With Her Meaty Pussy And Started Shaking Her Ass Until She Came!

  • censoredbig titsuniformDORIfirst starsucking shootingDORI-018DORI018h-491dori00018
    • 2021-04-15
    220 min

    [NASH-495]A Local Wife Fucked Like In A Japanese Artistic Romance Paperback - Yume Hakuchu 3

  • censoredbig titsmature womanNASHpinkshinryu takeshinadeshikoNASH-495NASH495nash00495
    • 2021-04-24
    118 min

    [XVSR-590]Bubble Princess Paradise: The Soapland Brothel Babes Who Will Absolutely Let You Creampie Them Rika Aimi

  • rumi tadami censoredcreampiebig titsXVSRmax ashanty yazawacalenXVSR-590XVSR590xvsr00590
    • 2021-05-07
    125 min

    [FSDSS-220]My Dick Got Impossibly Hard As I Watched My Beloved Girlfriend With Colossal Tits Get Brainwashed And Fucked By My Sadistic Boss. Sara Kamiki

  • sara kamiki censoredbig titssingle workFSDSSfalenokicchomufaleno starFSDSS-220FSDSS2201fsdss00220
    • 2021-05-07
    123 min

    [FSDSS-217]Hey Old Man, If You Really Like Having Your Nipples Played With That Much, How About I Keep Teasing Them For A Whole Day Straight？ Nene Yoshitaka

  • nine yoshitaka censoredsluthandjobFSDSSfalenoakirafaleno starFSDSS-217FSDSS2171fsdss00217
    • 2021-05-07
    66 min

    383REIW-062 Narumi

  • amateur censoredcreampiebig titsreiwreiw-062reiw062383reiw-062
    • 2021-05-11
    105 min

    261ARA-487 [Beautiful woman who is too bewitching] 23 years old [Swan’s dick is a lake] Haruki-chan is here! The reason for her application as a pharmacist is "I’m lonely …" Self-medication is the limit! A tight erotic body wit

  • amateur censoredamateuraraara-487ara487261ara-487
    • 2021-05-15
    120 min

    [AQSH-069]This NEET Married Woman Wanted To Become An Amateur Magazine Model So When This Guy Said He Was A Producer Who Could Hook Her Up She Took The Bait And He Made Her Go Through A Filthy And Sexually Demoralizing Experience

  • yoko yamaguchi censoredcreampiemature womanAQSHaquamall heroaquamallAQSH-069AQSH069aqsh00069
    • 2021-06-09
    45 min

    [060921-001][VR] Luxury Adult Healing Spa: Sena Kusunoki

  • sena kusunoki uncensoredhandjobbukkakecaribbeancom
    • 2021-07-01
    72 min

    FC2PPV 1897067 [Magi Reverse 3P] Let’s reverse 3P Harlem with the magical girl! Two amateur layers squeeze the dirt of a former virgin who is not accustomed to Ecchi / Ma 〇 Magi Ma 〇 Ka & Hora Magical Girl Ver ※ Complete appearance / raw vagi

  • amateur uncensoredfc2
    • 2021-07-10
    164 min

    [CEMD-034]She Gets Flirty and Open! Shame Play Rin Miyazaki - With Unfocused Eyes "I want to fuck already!" She Says.

  • miyazaki rin censoredcreampiemature womanCEMDceleb no tomoCEMD-034CEMD034cemd00034
    • 2021-07-17
    145 min

    [CAWD-243]I Wasn't Sure if She'd be Able to do it the First Time, but I Creampied Her Again and Again, Practicing my Fucking on her with Animal Desire. Mayuki Ito.

  • maiyuki ito censoredcreampiesingle workCAWDkawaiibungo maedaCAWD-243CAWD243cawd00243
    • 2021-07-18
    240 min

    [SCOP-733]G-Cups And Up! Girls With Big Tits Go Bouncing For Creampie SEX 4-Hour BEST Collection

  • censoredcreampiebig titsSCOPscooptaro kSCOP-733SCOP733scop00733
    • 2021-08-01
    115 min

    [AMBI-132]The Secret Lovey-Dovey Married Life Of The Deputy Head Teacher And Me. Ichika Nagano.

  • ichika nagano censoredcreampieschoolgirlAMBIplanet plusdirector oanbibarentsuAMBI-132AMBI132h-237ambi00132
    • 2021-08-06
    119 min

    [MEYD-693]Come Inside Me Today Until I Get Pregnant... Sakura Misaki

  • cape sakura censoredcreampieslutMEYDtameike gorooomura daiMEYD-693MEYD693meyd00693
    • 2021-09-01
    120 min

    [NACR-457]An Outrageous Promise To Not-My-Stepson Ayane Sezaki

  • ayane sezaki censoredcreampiemature womanNACRplanet plussakura ninshichi ku ryuuNACR-457NACR457h-237nacr00457
    • 2021-09-02
    64 min

    Pacopacomama 090221_526 The Training For Wife: Beautiful Wife who is My Sex Toy Loves to Be Dominated Hitomi Yoshimura

  • amateur uncensoredpacopacomama
    • 2021-09-05
    24 min

    FC2PPV 2153989 First Post. Limited Number Of "# 1" F Cup Beautiful Breast Nursery Teachers. She Pours Her Love Into A Fascinating Body. One-Sided Feelings → Both Feelings ♡

  • amateur uncensoredfc2
    • 2021-09-08
    126 min

    241GAREA-525 Maina

  • amateur censoredamateurbeautiful girlgareagarea-525garea525241garea-525
    • 2021-09-10
    214 min

    [HUNTB-093]"You"re Always Looking At My Tits, Aren"t You...？" A Quiet And Shy Plain Girl Close To Me Is Hiding Both Her Massive Tits And Her Intense Sexual Desires! And I"m The Only One Who Finds Out...

  • censoredcreampiebig titsHUNTBhuntercognac kaminohhh groupHUNTB-093HUNTB093huntb00093
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-25
    128 min

    [CEMD-060]The Filthy Snake-Tongued Dirty Talk Counseling Bar Honoka Tsujii I"ll Solve All Of Your Perverted Problems With My Snake-Like Tongue!

  • tsujii honoka censoredbig titsmature womanCEMDserebu no tomoCEMD-060CEMD060cemd00060
    • 2021-10-07
    80 min

    [REBD-592]Rikka Manatsu"s Snowflakes Rikka Ono

  • rokka ono censoredsingle workREBDrebeccasawamura akiraREBD-592REBD592h-346rebd00592
    • 2021-10-15
    99 min

    277DCV-192 Is It Okay To Send It Home？ Case.186 [* Be Careful Of Eardrum Explosion! Gasping Voice Max! It’s Too Masochistic And Full Of Highlights Sp] ⇒ Strangling Iki, Nipple Iki, Iramaiki, Just Sweaty And Crazy Iki! Gakuburudo M Makai! ⇒ Perfe

  • amateur censoredsquirtingamateurdcvdcv-192dcv192277dcv-192
    • 2021-10-15
    148 min

    [EBOD-864]"I Want To Make A Living Doing What I Love (Sex)" She"s A Beautiful Professional Beautician (A Junior Stylist) Who Has Been Profiled In Fashion Magazines She"s Made The Decision To Retire From The Beauty Salon Industry She&q

  • minami peach censoredbig titssingle workEBODe bodyarashiyama michiruEBOD-864EBOD864ebod00864
    • 2021-11-06
    120 min

    [NSFS-040]Mature Mother 16. Mother Who Allowed Son-in-law to Touch Her On Request Chisato Shoda

  • shota chisato censoredmature womanmomNSFSnagae styletomitake taroNSFS-040NSFS040nsfs00040
    • 2021-11-12
    177 min

    [PPPD-973]"Dear Parents. I"m Making My Porn Debut" By J-Cup Big Tits Porn Debutant In Tokyo After Graduating Rural University. Riko Onozaki

  • riko onozaki censoredbig titssquirtingPPPDoppaiPPPD-973PPPD973pppd00973
    • 2021-11-19
    82 min

    259LUXU-1514 Luxury TV 1485 A Nurse With A Beautiful Smile Appears In Search Of Stimulation, Saying "Normal Sex Is Not Enough …"! The More You Feel It, The More Bewitching It Will Be, And The More You Feel It, The More You Will Repeat Th

  • amateur censoredamateurluxuluxu-1514luxu1514259luxu-1514
    • 2021-11-25
    484 min

    [FCDSS-019]Noai Miura FALENO First Best 8 Hours - A Sensitive, Beautiful Girl Who Becomes Incontinent, Cums, And Becomes Covered In Semen And Saliva

  • miura noai censoredbeautiful girlslutFCDSSfalenofaleno starFCDSS-019FCDSS0191fcdss00019
    • 2021-12-10
    127 min

    [BBAN-351]Two Cute Girls Kissing And Drooling Over Each Other, W Lesbian Ban, Yuzu Shirakawa, Rin Miyazaki.

  • yuzu shirakawa miyazaki rin censoredlesbianbeautiful girlBBANbibianBBAN-351BBAN351bban00351
    • 2021-12-17
    161 min

    [MIDV-020]In The Countryside Where Her Husband Was Transferred... Bored And Bored, She Seduced A Man In The Neighborhood, Straddled Him Without Permission, And Kept Swinging Her Hips... Fumika Nakayama

  • nakayama fumika censoredbig titsslutMIDVmoodyztrendy yamaguchimoodyz divaMIDV-020MIDV020midv00020
    • 2021-12-17
    120 min

    [MEYD-723]Our Office Is Promoting A Work-From-Home Lifestyle, And Now I"m Alone With My Horny And Totally Sexy Married Woman Lady Boss. From The Afternoon Until The Next Morning, She"s Driving Me Hard With Excessive Work And Making Me Hit A N

  • cape sakura censoredcreampieslutMEYDtameike gorokogoro kindaichiMEYD-723MEYD723meyd00723
    • 2021-12-20
    80 min

    318LADY-394 Mio (Mio Ichijo)

  • amateur censoreduniformschoolgirlladylady-394lady394318lady-394
    • 2022-01-07
    63 min

    10musume 010722_01 Sex With An Intern Girl Who Is Clumsy But Cute Mitsuki Harutori

  • amateur uncensored10musume
    • 2022-01-22
    35 min

    FC2PPV 2610987 First Shot [New Cinema Style] Limited Number [Uncensored] "I Have Been Interested Since I Was A Student …" The Feelings Conveyed After Several Years. The Day When I First Connected With A Pretty And Busty Beautiful Girl. I

  • amateur uncensoredfc2
    • 2022-02-04
    147 min

    [SSIS-322]Overnight Hot Springs Date: Going From Shy To Love To Cumming Like Wild! Our Date Plan Also Includes Trying Out Bondage And Other Perverted Things Starring Nanami Ogura

  • nanami ogura censoredbeautiful girlsingle workSSISs1 no 1 stylemichiru arashiyamaSSIS-322SSIS322ssis00322
    • 2022-02-10
    125 min

    [STARS-502]巨根特化!大好物のデカチンに超興奮(ハート)子宮奥ズボズボで感度バカになる大絶頂セックス!! 工藤ゆら

  • censoredsoloworkSTARSsod createyujiroSTARS-502STARS502
    • 2022-02-18
    120 min

    [SSIS-326]In Front Of Everyone, Tsukasa Aoi Will Make Close Contact With You From Behind And Whisper And Be A Reverse Pervert To You.

  • tsukasa aoi censoredsluthandjobSSISs1 no 1 stylegoemonSSIS-326SSIS326ssis00326
    • 2022-02-19
    242 min

    [UMSO-437]A Beautiful Girl"s Cute Ass. Special. 60 Girls.

  • reina fujikawa jinguji temple nao censoredbeautiful girlUMSOk m produceumanamiUMSO-437UMSO437umso00437
    • 2022-02-26
    181 min

    [SORA-368]Consuming Cum. Outdoor Cum Swallowing Party. Mai Hoshikawa

  • hoshikawa mai censoredsingle workSORAyama to sorahimu lockSORA-368SORA368sora00368
    • 2022-03-01
    81 min

    261ARA-530 [Beautiful Office Lady] [Neat And Duero] Megu-Chan Is Here! "I Can’t Sleep, So I Have Sex W" I’m Frustrated At Work And Can’t Sleep Every Day. In Such A Case, Sex Will Solve It! ？？ If You Keep Going, You’ll Be

  • amateur censoredsquirtingamateuraraara-530ara530261ara-530
    • 2022-03-04
    85 min

    529STCV-068 [Natural Erotic Pheromone ♪ Perfectly Beautiful Body Troupe Crusher In Asagaya] All The Guys In The Troupe Have A Physical Relationship! ？？ A Theater Company Crusher Girl Who Breaks The Human Relations In The Group Has Appeared! Good Milk

  • amateur censoredcreampiebig titsstcvstcv-068stcv068529stcv-068



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi