shiro shoten




FC2HDKABLKONEZCJODVEMAMARABBANABWGVHMEYDDASDNATRMIDECAWDSSISMILKPPPDHMNMIDVCHRV

2020-11-27
30 min

359TYVM-108 G Cup Plump Big Areola Wife Motherhood Explosion Breastfeeding Play Creampie Sex! !!

  • amateur censoredcreampiebig titstyvmtyvm-108tyvm108359tyvm-108
    • 2020-12-10
    70 min

    435MFC-062 Chino

  • amateur censoredcreampieamateurmfcmfc-062mfc062435mfc-062
    • 2020-12-25
    126 min

    [KBI-049]Married Woman Creampie - Adultery At A Hot Spring - 4 Forbidden Creampie Loads! Someone Else's Wife Is Your Exclusive Cum Dumpster. Minami Shiratori

  • minami shiratori censoredcreampiemature womanKBIprestigeshimikkikanbiKBI-049KBI049118kbi00049
    • 2021-01-12
    118 min

    [STARS-319]All Alone With My Hot Employee, Everyone Else Is Working From Home. She's Got A Boyfriend... But She Doesn't Seem To Mind. Fucking From Nine To Five, Then Some Overtime. Forget About Your Deadlines With Incredible Multiple Back-To-

  • asahina nanase censoredsingle workdramaSTARSsod createkirinsod starSTARS-319STARS3191stars00319
    • 2021-01-15
    120 min

    [NATR-649]She Loves Sex! My Brother`s Too Naughty Wife!! Yume Izumi

  • yume izumi censoredcreampiebig titsNATRnadeshikobito sakuraNATR-649NATR649h-067natr00649
    • 2021-01-15
    293 min

    [SUPA-561]東京素人J●ナマハメ流出映像 2

  • censoredschoolgirlamateurSUPAs kyuu shiroutoSUPA-561SUPA561h-244supa00561
    • 2021-02-05
    271 min

    [DNW-109]Dear Beautiful Clerk. 01

  • censoredcreampiebig titsDNWprestigedocument nowDNW-109DNW109118dnw00109
    • 2021-02-07
    101 min

    [SCD-190]Slut MILF That Made Me D***k Aphrodisiacs Chisato Shoda

  • shota chisato censoredbig titsmature womanSCDrubyhiroyuki kimurascoopSCD-190SCD190scd00190
    • 2021-02-25
    107 min

    [IENF-126]Sexy Older Sisters With Big Tits Talk Dirty To You As They Play With Their Nipples And Jerk Off 5

  • hosei lily tsujii honoka censoredbig titsIENFienergyienfIENF-126IENF1261ienf00126
    • 2021-02-25
    23 min

    HEYZO 2468 Erotic Massage for Yuki – Yuki Sasaki

  • yuki sasaki uncensoredblowjobcumshotheyzo
    • 2021-03-01
    121 min

    [NACR-398]Hold Me... The Single Mother Who Fell In Love With Her Neighbor Mitsuha Higuchi

  • mitsuha higuchi censoredcreampiesingle workNACRplanetdirector oshichidomeNACR-398NACR398h-237nacr00398
    • 2021-03-12
    56 min

    383REIW-034 An

  • amateur censoredcreampieamateurreiwreiw-034reiw034383reiw-034
    • 2021-03-26
    130 min

    [PED-007]We Left The Two Of Them Alone For Just 7 Hours... In The End, They Banged 11 Times. Rui Hizuki

  • rui hizuki censoredsingle workPEDdream ticketkurumi ichinosePED-007PED00724ped00007
    • 2021-03-26
    239 min

    [NASH-479]First Time Shots: Lewd, Beautiful Mature Women - Only Good Women Edition

  • censoredcreampiemature womanNASHnadeshikoNASH-479NASH479h-067nash00479
    • 2021-04-01
    90 min

    [REBD-547]Mako: Turn Around On My Call - Mako Shion

  • miko shion censoredsingle workREBDrebeccachikara sawamuraREBD-547REBD547h-346rebd00547
    • 2021-04-02
    118 min

    [BBAN-320]Horny Modern Punk Girl At An All Girls School Finds A Way To Release Her Sexual Frustration I've Got It! I Can Just Fuck Other Girls!

  • tianhe uzuki liana censoredlesbianBBANbibianBBAN-320BBAN320bban00320
    • 2021-04-09
    148 min

    [MIDE-912]Super Steamy, Sweet, And Sexy Losing My Virginity In The Best Way Possible Nozomi Ishihara

  • ishihara hope censoredbig titsblowjobMIDEmoodyzdragon nishikawamoodyz divaMIDE-912MIDE912mide00912
    • 2021-05-01
    164 min

    [DOKS-542]Beautiful Y********l In School Uniform With A Hairy Pussy Urara Kanon

  • hanaoto urara censoreduniformschoolgirlDOKSoffice k sgonzaburo onigawaraDOKS-542DOKS54236doks00542
    • 2021-05-01
    243 min

    [NACX-077]60 Mature Woman Babes Who Continue To Shake Their Asses During Cowgirl Sex vol. 02

  • kaho shibuya narumiya harua censoredbig titsmature womanNACXplanet plusnanakuruNACX-077NACX077h-237nacx00077
    • 2021-05-05
    120 min

    [GVH-228]Perverted Wife Who Likes To Turn Men On By Not Wearing A Bra Or Panties Moved Next Door! Rika Tsubaki

  • tsubaki rika censoredslutsingle workGVHglory questkabin kizakuraGVH-228GVH22813gvh00228
    • 2021-05-09
    84 min

    FC2PPV 1808761 Prefectural ② Juniors also leaked-Limited quantity-

  • amateur uncensoredfc2
    • 2021-05-15
    120 min

    [OMHD-007]Possessed And Entranced I Possessed The Body Of A Woman With A Full Body Erogenous Zone, And Experienced A Hyper Ecstatic Hard-Fucking Female Orgasmic Trip Ayaka Mochizuki

  • ayaka mochizuki censoredsquirtingblowjobOMHDdogmamigiwa otaOMHD-007OMHD007omhd00007
    • 2021-05-21
    68 min

    510ELLO-008 G-Cup Beauty And A Child-Making Trip That Must Be Pregnant

  • amateur censoredcreampieamateurelloello-008ello008510ello-008
    • 2021-05-26
    146 min

    Caribbeancom 052621-001 Housewife Anthology Ai Uehara, Misuzu Tachibana, Akari Niyama, Nozomi Hazuki Miku Fujii

  • uehara misuzu uncensoredcreampiecaribbeancom
    • 2021-06-12
    119 min

    [AUKG-514]Denim Maniacs H

  • nagatsuki natsuki shizuka sugisaki censoredlesbianAUKGu krentoAUKG-514AUKG514aukg00514
    • 2021-06-19
    120 min

    [CAWD-241]Shared Room NTR During The Company Training Seminar This Moody And Gloomy Cherry Boy And His Arrogant And Prideful Girlfriend Experienced A Chemical Sexual Reaction And Began Creampie Fucking So Much Over The Course Of 3 Days That By The En

  • hatsukawa minami censoredcreampiesingle workCAWDkawaiimichiru arashiyamaCAWD-241CAWD241cawd00241
    • 2021-06-25
    238 min

    [BMW-236]Super Squirting Pussy! Convulsing And Trembling Orgasms From Pumping Piston Fuck Best!

  • bud julia censoredcreampiebeautiful girlBMWwanz factorywanzBMW-236BMW236bmw00236
    • 2021-07-01
    123 min

    [NACR-441]The Hot Wife From Next Door Mistakes My Apartment For Hers After Coming Home Wasted, Starring Lily Hoshou

  • hosei lily censoredbig titsslutNACRplanet plusdirector oshichi ku ryuuNACR-441NACR441h-237nacr00441
    • 2021-07-08
    127 min

    [SPRD-1434]Mother-in-Law, You Are Suddenly Way Better Than My Wife... Aoi Aoyama.

  • aoyama censoredmature womansingle workSPRDtakara eizokon oriharualeddinSPRD-1434SPRD143418sprd01434
    • 2021-07-10
    112 min

    300NTK-602 Drunk 4P! !! A big squirting beauty OL with a sticky horny butt! !! Drinking Ma ○ Ko Show off No rules for squirting No rubber With squirting Raw insertion entrance ceremony! ？？ In a rude lecture, straddle the boss and squeeze the waist fu

  • amateur censoredcreampiesquirtingntkntk-602ntk602300ntk-602
    • 2021-07-30
    135 min

    [JBD-271]Female Spy The Price of Betrayal Miu Ouka

  • miwa sakura censoredsingle workJBDattackersusubashi suihebi bakuJBD-271JBD271jbd00271
    • 2021-08-06
    56 min

    H4610 ki210810 Misaki Makino 25years Old

  • amateur uncensoredh4610
    • 2021-08-11
    105 min

    428SUKE-083 [Extra-Large Soft Boobs] Rent A Mobile Battery And Pacopaco Sp With A Soft Busty Beauty On The Way Home From A Trip! !! If You Take It Off At The Night Pool, Bonkyubon Is Amazing W I Can’T Wait To Reach The Hotel, And My Chest Is Ama

  • amateur censoredcreampiebig titssukesuke-083suke083428suke-083
    • 2021-08-13
    82 min

    259LUXU-1459 Luxury Tv 1443 A Beautiful Woman In Charge Of Public Relations Of A Certain Company Who Decided To Appear In AV With Interest In Her Eyes Gets Wet In Front Of The Camera And Gets Disturbed! She Will Serve As If She Loves The Big Cock In

  • amateur censoredamateurluxuluxu-1459luxu1459259luxu-1459
    • 2021-08-25
    101 min

    459TEN-024 [Hcup Fucking Goddess] Assault On The Home Of An H-Breasted Spear Man Gal Captured In Shibuya! !! Bombshell Fuck With Special Game Underwear! !! Hami Milk That Does Not Fit In The Game Underwear Is Erotic To The Strongest Level Ever! A Sma

  • amateur censoredcreampiebig titstenten-024ten024459ten-024
    • 2021-08-31
    46 min

    292MY-475 Ishihara karen 1

  • amateur censoredmarried womanamateurmymy-475my475292my-475
    • 2021-09-01
    120 min

    [NACR-454]Confinement And Influence: I Was Disciplined By My Brother-in-law - Akane Shiki

  • akane shiki censoredcreampieblowjobNACRplanet plussakura ninshichi ku ryuuNACR-454NACR454h-237nacr00454
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-16
    83 min

    [REBD-587]Ichika2 Whimsical Honeymoon Ichika Matsumoto

  • ichika matsumoto censoredsingle workREBDrebeccasawamura akiraREBD-587REBD587h-346rebd00587
    • 2021-09-25
    159 min

    [DGCEMD-060]*For Streaming Editions Only! Cums With Bonus Footage* She"s Using Her Crude And Vulgar Snake-Like Tongue At The Dirty Talk Counseling Bar Honoka Tsujii I"ll Resolve All Of Your Perverted Problems With My Snake Tongue!

  • tsujii honoka censoredbig titsmature womanDGCEMDcelebrity friendsDGCEMD-060DGCEMD060dgcemd00060
    • 2021-10-20
    121 min

    [KIR-046]Cuckolded Big Tits Wife Creampie

  • maki kyoko mayu satomi censoredcreampiebig titsKIRstar paradisekirei star paradiseKIR-046KIR046h-254kir00046
    • 2021-10-30
    121 min

    [BKD-271]Stepfamily Fuck [Road To Okushiobara] Hibiki Otsuki

  • otsuki sound censoredcreampiemature womanBKDrubytsuji koujitabijiBKD-271BKD271bkd00271
    • 2021-11-05
    228 min

    [URE-073]Exclusive: Ririko Kinoshita Cums Relentlessly In Family Interplay!! Original:Gonza. Mother-in-law"s Pride In Son-in-Law. POV Record of Activities.

  • kinoshita rinko censoredmature womansingle workUREmadonnakitorune kawaguchiure komiURE-073URE073ure00073
    • 2021-11-11
    80 min

    TKK-008 Hinata Iwasaki (Rina Hinata)

  • amateur censoredcreampieamateurtkktkk-008tkk008tkk-008
    • 2021-11-13
    100 min

    [SUJI-146]Small Shaved Pussy Creampie~ Fetish Pervert"s Filthy Obscenities~ Rara Kudo 142cm

  • lara kudo censoredcreampiebeautiful girlSUJIkan ran monoSUJI-146SUJI146suji00146
    • 2021-11-18
    59 min

    FCP-053 [Delivery Only] Muchipuri Best Ass Job! !! ＃ 3 I’ll Make You Feel Good With My Big Ass …! !! (MIYABI Mizuki Yayoi Kanon Kibuki)

  • amateur censoredamateurbeautiful girlfcpfcp-053fcp053fcp-053
    • 2021-11-19
    119 min

    [DASD-941]The Old Guy Possesses Kotone Toua. He Takes Possession of a Beautiful Girl Addicted to Being Slim, and in Her Place, has Hot Sex wih the Customers.

  • toua kotone censoredcreampiesingle workDASDdasmishima rokusaburoDASD-941DASD941dasd00941
    • 2021-11-29
    52 min

    FC2PPV 2471454 Limited Number! !! [Uncensored] Twilight Date On The Beach At Sunset With The Receptionist Of The Beauty Clinic … Obscene In A Closed Room With A Viewer And The Last Vaginal Cum Shot On An Elegant Body! !! This Is Her Last Work &#

  • amateur uncensoredfc2
    • 2021-12-04
    140 min

    [PKPR-005]Totally Private Videos This Beautiful Lady Is A Former Nurse Who Has H-Cup Titties And Is Squirting Like Crazy Your First Sleepover With Yayoi Yoshino Yayoi Yoshino

  • yayoi yoshino censoredcreampiebig titsPKPRpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPR-005PKPR005pkpr00005
    • 2021-12-08
    45 min

    511SDK-018 [Production Ok] Sex With A High-Class Delivery Health Lady And Raw Vaginal Cum Shot. Too Dense Time Drowning In Libido

  • amateur censoredbig titsamateursdksdk-018sdk018511sdk-018
    • 2021-12-09
    200 min

    [MOGI-009]体育教師を志す現役女子大生を朝から晩まで羞恥漬けにする輪姦中出し温泉旅行 初音あきら(仮)21歳

  • censoredcreampieMOGIsod createakai suiseimogitateMOGI-009MOGI009
    • 2021-12-17
    124 min

    [MVSD-490]Let"s Go To HEAVEN! Peniban Girls Dig Me Up And I Faint In Agony! Anal Cancelling All Night! Ichika Matsumoto Mei Satsuki

  • ichika matsumoto satsuki mei censoredcreampiebeautiful girlMVSDm s video groupsamoariMVSD-490MVSD490mvsd00490
    • 2022-01-07
    115 min

    [ROE-035]MONROE Exclusive Third Release! To The Ends Of Lust ~ Sweaty And Immoral Sex Between A Step Mother And Step Son ~ Miki Yoshii

  • good miki ryoko izawa miki yoshii censoredbig titsmature womanROEmadonnatakeshi kogamonroeROE-035ROE035roe00035
    • 2022-01-14
    121 min

    [EBOD-884]I Can"t Refuse To Ejaculate When My Girlfriend, Who Is Taller Than Me And Very Plump, Touches My Nipples With Her Chewy Female Body.

  • kazuhana seta censoredcreampiesingle workEBODe bodymiyoshi rusherEBOD-884EBOD884ebod00884
    • 2022-01-18
    17 min

    FC2PPV 2602672 [Personal Shooting / Gonzo] Gonzo Is Taken By Leaving The Child In A Nursery, The Married Woman Is Betrayed Because She Became A Guarantor Of An Acquaintance, And The Body Collapses By Forced Vaginal Cum Shot

  • amateur uncensoredfc2
    • 2022-01-29
    139 min

    [PKPT-007]The 18-Year Old Girl Who Is OK With A Creampie While Engaged In Compensated Dating. With Her J-Cup Tits And MAXIMUM Sex Drive, She Jacks You Off For 5 Shots. Alice Kisaki.

  • kisaki alice censoredcreampiebig titsPKPTfuck group and fun friends daydreamersPKPT-007PKPT007pkpt00007



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi