small milk jav high vision mini system javcensored




FC2VENUMILKNATRDASDSPRDPREDAWDMARASSISMEYDBLKSANMIAAHNDRBDMVSDDTTNACXHODVAUKG

2020-11-12
123 min

[RCTD-363]Lesbian Battle Queen Final Battle 2020 - Akari Niimura VS. Ako Momona

  • akari shinmura ako momona kou akemi mari koizumi censoredlesbianRCTDrocketscarecrowRCTD-363RCTD3631rctd00363
    • 2020-11-15
    62 min

    SIRO-4337 [First shot] [Lady raised in girls’school] [Obscene study session] After school in autumn when a serious lady raised in girls’ school is disturbed and panting. A nasty foolery that a beautiful girl who becomes bold fascinates. App

  • amateur censoredamateursirosiro-4337siro4337siro-4337
    • 2020-12-10
    242 min

    [HEZ-232]Creampie Hot Spring Trip With A Busty Married Woman "Sorry Sweetheart... You'll Have To Forgive Me For Today" These Flirtatious Cheaters Are Sexier Than Your Wife Will Ever Be

  • censoredcreampiebig titsHEZhot entertainmentmarried woman hot entertainmentHEZ-232HEZ23259hez00232
    • 2020-12-18
    46 min

    444KING-023 Aoi-san

  • amateur censoredcreampiemarried womankingking-023king023444king-023
    • 2020-12-20
    154 min

    [CAWD-160]She's Pure And Honest And Full Of Lust! This Beautiful Girl Has Soft And Plump Skin 19 Years Old Nozomi Aota Her Adult Video Debut

  • aoda nozomi censoredcreampiebeautiful girlCAWDkawaiikyoseiCAWD-160CAWD160cawd00160
    • 2020-12-20
    119 min

    [HND-932]Hyena Sex A Silent And Powerless Barely Legal Babe Gets Sent To Creampie Hell Aoi Nakajo

  • nakagusuku censoredcreampieuniformHNDhon nakarakudaHND-932HND932hnd00932
    • 2020-12-25
    242 min

    [NASH-426]I Cannot Tell My Husband About My Relationship With My Father-in-law All 6 Stories

  • hina nanami hina nanase kanae kawahara censoredNASHnadeshikoNASH-426NASH426h-067nash00426
    • 2021-01-03
    59 min

    413INST-084 [Orgy / Personal shooting] K② Female manager ♀ child who is spoiled with a sexually active soccer boy member ww

  • amateur censoredcreampieschoolgirlinstinst-084inst084413inst-084
    • 2021-01-09
    118 min

    [DASD-796]Thanks For The Family Fuck. Finally Meeting The Girl Of The Chick I Knocked Up Decades Ago. Ten Hasumi Miho Tono

  • hasumiten miho tsuno censoredcreampiebeautiful girlDASDdaschinpo dazaiDASD-796DASD796dasd00796
    • 2021-01-31
    52 min

    FC2PPV 1667228 ☆ Today’s limited p ☆ [Fan participation type 5P orgy] It’s different from what I heard … Triple Three Uetamamusume (20) with beautiful skin and beautiful breasts blooms Doem at the 5P site suddenly thrown in. She repeat

  • amateur uncensoredfc2
    • 2021-02-07
    108 min

    300MIUM-673 [Titty Fuck Goddess] Rent a dental hygienist with the strongest attack power as her! Completely REC the whole story that was spoiled up to the originally prohibited erotic acts by persuading! !! After enjoying a swimsuit date, Erokos SEX

  • amateur censoredbig titsamateurmiummium-673mium673300mium-673
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-27
    118 min

    [MIDE-892]Switching Places! Investigator Nao Continues To Be Fucked With Overwhelming Strength - Nao Jinguji

  • jinguji temple nao censoredcreampiebig titsMIDEmoodyzusa pyonmoodyz divaMIDE-892MIDE892mide00892
    • 2021-02-28
    120 min

    [XVSR-580]Erotic Novel: A Married Maid - Please Look At My New Wife's Body - Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcreampiebeautiful girlXVSRmax ak c takedacalenXVSR-580XVSR580xvsr00580
    • 2021-03-17
    47 min

    492MERC-285 Ro-Kon bastard aiming for prey in the park 2

  • amateur censoredcreampieamateurmercmerc-285merc285492merc-285
    • 2021-04-06
    184 min

    [SDNM-274]Beautiful Caretaker Happily Serves Old Men Every Day Miyu Kurita 28 Years Old Porn Debut

  • miyu kurita censoredsingle workSDNMsod createcompany matsuogenuine married woman the porn experienSDNM-274SDNM2741sdnm00274
    • 2021-04-24
    240 min

    [XVSR-592]Hikaru Konno 8 Works x 4 Hours

  • hikaru konno censoredcreampiedramaXVSRmax amax ikacalenXVSR-592XVSR592xvsr00592
    • 2021-05-01
    113 min

    [AMBI-127]My Secret Love Life With My Homeroom Teacher Saya Matsui

  • saya matsui censoredcreampieschoolgirlAMBIplanet plusdirector oanbibaresotsuAMBI-127AMBI127h-237ambi00127
    • 2021-05-06
    42 min

    475SKCK-032 Kaname 6

  • amateur censoredanalamateurskckskck-032skck032475skck-032
    • 2021-05-14
    118 min

    [MVSD-463]Your Buddy's Sister Tried To Tempt You Into Losing Your Virginity To Her, But She Had No Idea How Much You'd Learned From Porn! The Tables Are Turned As You Rail Her To Incredible Orgasms, And She Agrees To Your Creampie! Sakura Tsu

  • sakura tsuji censoredcreampieslutMVSDm s video groupMVSD-463MVSD463mvsd00463
    • 2021-05-28
    116 min

    483SGK-026 [Osaka assault SP] [Brain god Iki Osaka GAL] [Convulsions climax enough to shake Osaka] [Creampie OK! No NG] [Barrage 3P overwhelming 3 shots] [Honmamon’s metamorphosis] Gal Sutagram Osaka advance! ？？ ︎ SP who went to see the introduc

  • amateur censoredcreampieamateursgksgk-026sgk026483sgk-026
    • 2021-06-04
    124 min

    [HODV-21581]She Calls Herself A Super Masochist, Breaking In A Deepthroat Demon!! Yuria Nanamiya

  • yuria nanamiya censoreddeepthroatsingle workHODVh m pHODV-21581HODV215815642hodv21581
    • 2021-06-05
    109 min

    390JAC-092 [Perfect BODY x 5 consecutive vaginal cum shot] what ’s up Tokai ON AIR？ No, no, no, no, no, no, no, no, no, no, no! Supported by celebrities in each media, the gal boss is still fine today! Tokai respect collaboration request! Cheer up! D

  • body censoredcreampiebig titsjacjac-092jac092390jac-092
    • 2021-06-08
    62 min

    SIRO-4546 [First shot] [Strong gal x beautiful breasts nice ass] A big cock piston that is merciless to a strong gal whose facial expression gradually changes. She is fascinated by her S-class style and panting .. AV application on the net → AV exper

  • amateur censoredamateursirosiro-4546siro4546siro-4546
    • 2021-07-05
    80 min

    345SIMM-650 [NTR] Plump busty wife drips love juice in close contact nude shooting with a young male model … Continuous convulsions cum with another stick while her husband is away [Memorial nude photo shooting]

  • amateur censoredbig titsmarried womansimmsimm-650simm650345simm-650
    • 2021-07-09
    148 min

    [MIAA-468]Sexually Frustrated Nipple Slut Does Nipple Play With Young Wife Who Can't Stop Staring At Her Breasts Through Her Thin Clothes Sakura Tsuji

  • sakura tsuji censoredcreampieslutMIAAmoodyzdoragon nishikawaminna no kikatanMIAA-468MIAA468miaa00468
    • 2021-07-14
    158 min

    [PPPD-940]OPPAI & E-BODY Dual Exclusive: Arisu Kisaki's OPPAI Debut! Megaton J-Cup Titties, First Orgasm SPECIAL

  • kisaki alice censoredbig titssquirtingPPPDoppaiPPPD-940PPPD940pppd00940
    • 2021-07-21
    39 min

    527SROC-015 Mari (21)

  • amateur censoredamateursrocsroc-015sroc015527sroc-015
    • 2021-08-06
    89 min

    300NTK-616 [Hot! !! Hot! !! Hot! !! 3 Beautiful Bitch Girls And A Big Orgy In The Sun, Raw Insertion Sp! !! ] A Miracle That All Three Natural Beautiful Girls Are De Nasty Dovich! !! Simultaneous Insertion Of Raw Chin Under The Sun That Shines All Ma

  • amateur censoredcreampiesquirtingntkntk-616ntk616300ntk-616
    • 2021-08-10
    480 min

    [MUCH-134]Tight Pussy Muscles: Girls With Shaved Pussies 2: Having Sex With 10 People In A Row - 8 Hours, 2-disk Set

  • enomiya jun kawaguchi censoredbig titsMUCHmothermuchimuchiMUCH-134MUCH134h-796much00134
    • 2021-08-12
    188 min

    [NHDTB-561]An Anal Gal Coming Out Of Nowhere!! Moe Hazuki Lifts Her Ban On Anal And Gives An Enema Spray Outdoors

  • moe hazuki censoredsingle workNHDTBnatural highremonha to nakashimaNHDTB-561NHDTB5611nhdtb00561
    • 2021-09-03
    240 min

    [HODV-21608]Return Of The Posting A-Team - Plenty Of Lewds From Ultra-Slutty Amateur Hotties Special Feature, 4 Hours

  • censoredcosplayHODVh m pHODV-21608HODV216085642hodv21608
    • 2021-09-09
    104 min

    [GS-402]Step-cousin Comes To The City To Start College, Her Body Is More Mature Now And She"s Staying From The Afternoon Until Late For A Night Visit!! After A Long Tour Around The City, She Comes Back To My Room In Her Underwear For A Midday Nap

  • censoredschoolgirlGSsosoru x garconred ballGS-402GS402h-101gs00402
    • 2021-09-11
    161 min

    [TPIN-012]The Melancholy Of The Auntie In The K*d"s Room - A Horny Stepbrother With His Stepmom And Stepsister

  • censoredcreampielesbianTPINtsubakihoinTPIN-012TPIN012tpin00012
    • 2021-09-11
    56 min

    FC2PPV 2188931 Super Popular "Saki Hatsumi" [No] Raw Creampie Outflow 11 / Best Sex! Rookie Luxury Soap Lady Who Loves Vaginal Cum Shot On The First Day Of Entering The Store Part 2

  • amateur uncensoredfc2
    • 2021-09-16
    61 min

    FC2PPV 2210990 [New Work, Half Price! ] ♀ 325 Female College Student ◯ Ri-Chan 18 Years Old 1st Time First Shot! A Naive And Neat Black-Haired Young Girl Jd Makes A Complete Appearance With A Part-Time Job And Makes Her Av Debut With A Genuine Vagina

  • amateur uncensoredfc2
    • 2021-09-24
    139 min

    [JUL-711]A Super-Anticipated, Massive Exclusive From The Madonna Label, No.2!! Passionate Sex, So Hot It Will Make You Lose Your Mind, And Make You Lose Your Memory. The Genius Of All Geniuses, Finally Awakens. Minami Yasu

  • minami ahn censoredmature womansingle workJULmadonnamamezawa mametarouJUL-711JUL711jul00711
    • 2021-10-01
    158 min

    [SS-154]Fucking In Sailor Costume Summer Vacation Nakada Sailor Costume Raw Creampie 150 CM F Cup Big Tits Beautiful Ass Rina Takase

  • rina takase censoredcreampiebig titsSSpuramuse ra fuku to kikan boushirouto only plumSS-154SS154h-113ss00154
    • 2021-10-08
    125 min

    [JUL-741]キスから始まる社宅不倫 熱いくちびるの刺激に濡れる上司の妻 武藤あやか

  • ayaka muto censoredmature womansingle workJULmadonnabiba gonzoJUL-741JUL741jul00741
    • 2021-10-09
    139 min

    [URKK-045]The Perverted Landlord Next Door Rubs My Tits and Has Sex with Me Every Day, Hikari Sena

  • hikari sena censoredbig titssingle workURKKunfinishedrolandnyuukon no ichichichiURKK-045URKK045urkk00045
    • 2021-10-15
    56 min

    FC2PPV 2345920 * Until 10/17 3980⇒2980 ★ First Shot ☆ Small Breasts Slender Beauty ♥ Cool Beauty Manyi-Chan 22 Years Old ☆ Man Juice Cod To Blame Electric Massage! ♥ Cool But The Dick Is Wet And Wet Lust Cum Shot Ejaculation ♥ * With Benefits

  • amateur uncensoredfc2
    • 2021-10-22
    146 min

    [HMN-067]At The Creampie Bath House, The Girls Always Let Me Ride And Cum Bareback More Than Once Ichika Seta

  • kazuhana seta censoredcreampiebig titsHMNhonnakazack araiHMN-067HMN067hmn00067
    • 2021-10-22
    65 min

    FC2PPV 2363564 Up To 29 2180 [No] Beautiful Entertainer Beauty. 172 CM 42 Kg Fair-Skinned Slender Live Delivery Forcibly Commits A Beautiful Woman And Continuously Vaginal Cum Shot.

  • amateur uncensoredfc2
    • 2021-10-23
    112 min

    [GNAX-061]Watch And Then Read, Or Read And Then Watch! "New - Intruder" Michiru Kujo

  • kujo michiru censoredcreampiesingle workGNAXnagiranagira kenzonagira nagiraGNAX-061GNAX061gnax00061
    • 2021-11-06
    122 min

    [BACN-040]A Compliant Older Sex Friend - My Favorite Person, Who Gave Me All Her Body And Mind - Kanna Shiraishi

  • shiraishi plane censoredcreampieschoolgirlBACNbarutanmaboroshi kocandyBACN-040BACN040bacn00040
    • 2021-11-13
    120 min

    [AUKG-526]The Neighbors" Daylight Adultery, A Lesbian Series, Yuri Sasahara, Natsuki Takeuchi

  • yuri sasahara natsuki takeuchi censoredlesbiandramaAUKGu krentoAUKG-526AUKG526aukg00526
    • 2021-11-19
    149 min

    [HMN-075]If You Fuck Her Once, You"ll Want To Fuck Her Again, In The Raw! She"s Such A Sexual Genius, Even Adult Video Actors Will Want Second Helpings!! Her First Raw Creampie Fuck Fest Rion Kanami

  • rion kanami censoredcreampiesquirtingHMNhonnakamonHMN-075HMN075hmn00075
    • 2021-11-20
    86 min

    [AGMX-098]Licking Nipples While Titty Fucking

  • ayaka hirosaki umi hyuga censoredbig titsslutAGMXsex agentyuki mogueraAGMX-098AGMX098agmx00098
    • 2021-12-07
    39 min

    494SIKA-128 Make An Active Actress Drink An Aphrodisiac And Make A Vaginal Cum Shot 3P

  • amateur censoredamateursikasika-128sika128494sika-128
    • 2021-12-18
    22 min

    FC2PPV 2525943 [Personal Shooting] A Wine Bar Clerk Who Met A Father In A Wine Class Faints In Agony With His Relentless Vaginal Attack! !!

  • amateur uncensoredfc2
    • 2021-12-19
    62 min

    230OREC-962 Hikaru (Hikaru Minazuki)

  • amateur censoredcreampieamateurorecorec-962orec962230orec-962
    • 2021-12-19
    71 min

    383REIW-101 Yui

  • amateur censoredcreampieamateurreiwreiw-101reiw101383reiw-101
    • 2021-12-24
    120 min

    [NAD-006]This Gal Is In Charge Of My Nipples - Ayaba Isshiki

  • isshiki ayaba censoredcreampieblowjobNADdream ticketpiromu matsukataNAD-006NAD00624nad00006
    • 2021-12-24
    119 min

    [HMN-092]The Day My Insanely Detestable And Lewd Manager Where I Work Gave Me Non-stop Orgasms... From That Day On He Kept Marking Me With Creampie Loads At Work And On Days Off Too... Aoi Amano

  • ao amano censoredcreampiebig titsHMNhon nakamametaro mamezawaHMN-092HMN092hmn00092
    • 2022-01-04
    89 min

    500DPL-0044 The Best Mouth Onaho! Blonde No.1 Miss Pinsaro Minami Iroha

  • amateur censoredamateurbeautiful girldpldpl-0044dpl0044500dpl-0044
    • 2022-01-13
    120 min

    328STVF-057 Amateur Skirt In Personal Photo Session At Home Vol.057 [Lust] 4 Cosplayers Of Working Sisters Pheromones Floating Sweaty Breasts And Sweaty Pants!

  • amateur censoredbig titsamateurstvfstvf-057stvf057328stvf-057



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi