spay




FC2WAAAMIDVGVHGMEMONEZCJODROYDVENUSQTESSNICHRVAUKGVEMAFSDSSDASDSANSTARSAWDATIDCAWD

2020-10-15
47 min

[orec-610]ゆらさん

  • amateur censoredamateurorecorec-610orec610orec-610
    • 2020-10-22
    121 min

    [MILK-092]100cm Overwhelming Big Ass, Weird But Cute, A Plump Girl's Mad Sexual Intercourse - Haruna

  • censoredamateurbeautiful girlMILKmilkMILK-092MILK092h-1240milk00092
    • 2020-10-29
    59 min

    FC2PPV 1551027 [Uncensored] Super healing J ● Refre S class uniform beautiful girl and Ichaha creampie copulation !! J ● Refre Miss: Yui-chan (19 years old) ①

  • amateur uncensoredfc2
    • 2020-11-06
    226 min

    [HUNTA-881]"Hey Big Stepsister, Please Stop..." "I'm Sorry..." I Was Very Close With My Big Stepsister, But When The Bullies Ordered To Do It, She Couldn't Disobey, And She Fucked Me!

  • censoredcreampieschoolgirlHUNTAhunterkawajirihhh groupHUNTA-881HUNTA881hunta00881
    • 2020-11-19
    108 min

    [DDKH-004]Serious Climax Breaking In - Nozomi Arimura

  • arimura nozomi censoredcreampieDDKHdogmakanna flowerDDKH-004DDKH004ddkh00004
    • 2020-11-19
    61 min

    1Pondo 111920_001 3 Cumshots To A Superb Actress Jessica Takizawa Jessica Takizawa

  • amateur uncensored1pondo
    • 2020-12-01
    120 min

    [NACR-370]My Mother-In-Law Toyed With My Heart Tsubasa Hachino

  • yano tsubasa censoredcreampiemarried womanNACRplanet pluscherryshichidomeNACR-370NACR370h-237nacr00370
    • 2020-12-04
    115 min

    [PARATHD-3056]"These Curves Are Out Of This World!" MILF-Loving Producer In Tears On His Dream Set Full Of Smoking Hot Mature Girls - Married Woman, Mature Woman Best Collection 10

  • censoredbig titsamateurPARATHDparadise tvPARATHD-3056PARATHD3056parathd03056
    • 2020-12-06
    119 min

    [BKD-252]Family Fun [Yunishigawa Onsen Road] Arisa Shitara

  • shitara arisa censoredcreampiemature womanBKDrubykoji tsujitobijiBKD-252BKD252bkd00252
    • 2020-12-14
    76 min

    259LUXU-1357 Luxury TV 1339 A beautiful secretary with a strangely sexy mole on her mouth is here for the first time! The warmth and stimulation of men who are not satisfied in everyday life. In order to regain the pleasure and pleasure as a woman wh

  • amateur censoredamateurmature womanluxuluxu-1357luxu1357259luxu-1357
    • 2020-12-27
    121 min

    [KSBJ-110]Tempted By My Son's Wife - Natsuki Takeuchi

  • natsuki takeuchi censoredblowjobslutKSBJksb kikaku emmanuellebito sakuraKSBJ-110KSBJ110ksbj00110
    • 2020-12-27
    169 min

    [MDVHJ-027]Widow Fucked In Front Of Her Deceased Husband

  • riho yuki hotaru mori censoredcreampiemature womanMDVHJgraffiti japanmovieMDVHJ-027MDVHJ02748mdvhj00027
    • 2020-12-29
    39 min

    361SEKAO-139 Lianna from L.A

  • amateur censoredamateursekaosekao-139sekao139361sekao-139
    • 2021-01-12
    115 min

    [STARS-318]I Was On A Business Trip And At The Hot Spring Resort Inn, To My Surprise, I Was Booked Into The Same Room As My Newly Graduated Office Lady Colleague This Little Devil Is Luring Me To Temptation Reverse NTR Yuzu Shirakawa

  • yuzu shirakawa censoredbeautiful girlsingle workSTARSsod createhideyuki shinboSTARS-318STARS3181stars00318
    • 2021-01-22
    129 min

    [MBM-263]A Maid In Peril The Popular Girl At The Cafe She Was Tied Up By An Evil Customer And Fucked To Oblivion

  • censoredcosplayMBMprestigejanhirombmMBM-263MBM263118mbm00263
    • 2021-01-23
    120 min

    [HND-938]This College Girl Is A Genius Cowgirl Fucker Who Loves To Pound Penises With Cowgirl Sex, And She Came All The Way From Hakata For Her First Raw Creampie Fuck Saya Matsui

  • saya matsui censoredcreampiebeautiful girlHNDhon nakamametaro mamezawaHND-938HND938hnd00938
    • 2021-01-23
    140 min

    [CAWD-167]"Nipples Or Nothing!" Nipples Teased With Tongue Until It Drives Your Cock Crazy - Dual Naughty Sluts Take Your Nipples For A Tantalizing Ride For 11 Loads Mitsuha Higuchi Karen Otoha

  • mitsuha higuchi karen otoha censoredcreampieslutCAWDkawaiitiger kosakaiCAWD-167CAWD167cawd00167
    • 2021-02-19
    120 min

    [KSBJ-119]A Son's Wife Turned Out To Be A Lewd Woman, Through And Through... Maron Natsuki

  • marin natsuki censoredcreampieblowjobKSBJksb kikaku emmanuellebito sakuraKSBJ-119KSBJ119ksbj00119
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-22
    118 min

    [GENM-072]The Ultimate Beautiful Girl Will Lure You To Temptation At This Outdoor Warehouse 2 Amy Fukada

  • emi fukada censoredbeautiful girlslutGENMgenekig 3GENM-072GENM072genm00072
    • 2021-03-05
    43 min

    480FRIN-022 《Personal shooting》 Former female professional surfer 26 years old Sports drink CM appearance Certified instructor Hidden shooting

  • amateur censoredcreampiebig titsfrinfrin-022frin022480frin-022
    • 2021-04-05
    106 min

    [SCR-269]Lecherous Step Father Has Only One Goal - To Fuck His New Wife's Daughter! Upload Video

  • censoredcreampiebeautiful girlSCRglay zs crimeSCR-269SCR26912scr00269
    • 2021-04-09
    23 min

    FC2PPV 1721950 Natural Squirting Daughter ❤️ Former Reader Model Shiori Ito 26 Years Old ❤️ W Demon Ji ○ Port Seriously Squirting ❤️ Sequel to the 2nd Multiple Party There are many review benefits (including the previous full video)

  • amateur uncensoredfc2
    • 2021-04-22
    203 min

    [SW-771]The Perky Asses Of The S********ls In My Apartment Make My Cock Throb. Their Slender Legs And Their Adolescent Butts Peeking Out From Under Their Skirts Make Me Blow My Load.

  • censoredschoolgirlSWswitchlight fujimaSW-771SW7711sw00771
    • 2021-05-08
    243 min

    [UMSO-391]Secret Affair With Middle Aged Men POV Footage Of 10 Married Women Enjoying Fucking Around vol. 02

  • riho fujimori saori yagami censoredmarried womanmature womanUMSOkm produceumanamiUMSO-391UMSO391umso00391
    • 2021-05-28
    174 min

    [JUFE-291]A Special Summer Vacation, With My Teacher ... An Innocent, Fair-Skinned Beautiful Y********l With A Peachy Body, Soiled By A Middle-Aged Man's Semen Hana Shirato

  • white peach censoredsquirtingschoolgirlJUFEfitchJUFE-291JUFE291jufe00291
    • 2021-06-04
    120 min

    [PRED-316]The CEO's Secretary Came Onto Me By Teasing Me With Whispered Dirty Talk I'm A Regular Office Worker And She Made Me Cum Inside Of Her Airi Kijima

  • airi kijima censoredcreampieslutPREDpremiumkogoro kindaichielegancePRED-316PRED316pred00316
    • 2021-06-22
    61 min

    HEYZO 2551 Sexual Lesson For A Slutty MILF – Mari Onodera

  • mari onodera uncensoredcreampieheyzo
    • 2021-06-25
    117 min

    [MIMK-090]K**ling Time With My Niece - Live Action - Nana Yagi

  • nana yagi censoredsquirtingbeautiful girlMIMKmoodyzdragon nishikawamankitsuMIMK-090MIMK090mimk00090
    • 2021-07-08
    129 min

    [JRZE-060]First Time Filming My Affair Miyu Koizumi

  • yu koizumi censoredcreampiemature womanJRZEcenter villageminatoyashoku ureJRZE-060JRZE060h-086jrze00060
    • 2021-07-09
    84 min

    GALGAL-003 Hina

  • amateur censoredamateurslutgalgalgalgal-003galgal003galgal-003
    • 2021-07-20
    60 min

    HEYZO 2572 Toying With Sweaty Hot Chick! Vol.2 – Kurumi Kokoro

  • kurumi kokoro uncensoredcreampiehandjobheyzo
    • 2021-08-01
    247 min

    [ZMAR-046]All! Airi Natsume

  • natsume atago censoredcreampiesquirtingZMARplanet plusmaruttoZMAR-046ZMAR046h-237zmar00046
    • 2021-08-06
    138 min

    [HODV-21594]For My Use Only! Fucking Sluts Who Have Colossal Tits: Mating With, And Raising, As I Like Colossal Tits Girls Who Run Away From Home. Riina Asuka.

  • asuka riina censoredcreampiebig titsHODVh m pbottomsHODV-21594HODV215945642hodv21594
    • 2021-08-13
    240 min

    [PPBD-217]My Glans Is About To Explode! A Super Masochistic Girl"s Ejaculation Management She Stops Once She"s Brought You To The Brink - BEST

  • hitomi tsujii honoka censoredcreampiebig titsPPBDoppaiPPBD-217PPBD217ppbd00217
    • 2021-08-20
    120 min

    [SPZ-1113]Older Woman"s Masturbation...Overflowing With Moaning, Hidden Shots

  • censoredbig titsmature womanSPZstar paradisesuta paradaisuSPZ-1113SPZ1113h-254spz01113
    • 2021-08-28
    145 min

    [JKSR-506]10 A.M.: What About School...Suzu - Suzu Monami

  • monami bell censoredcreampieschoolgirlJKSRbigmorkalobockeypinkjunkyJKSR-506JKSR50657jksr00506
    • 2021-09-04
    159 min

    [YMDD-242]The Little Stepsister Catering Service - She Gets To Monopolize Her Big Stepbrother"s Love! An Innocent And Pure, Angelic Little Stepsister Is Playing Erotic Pranks On Me -

  • yuzu shirakawa kanon kanon censoredcreampieblowjobYMDDmomotarou eizou shuppanasakusa ga jirojaku momoYMDD-242YMDD242ymdd00242
    • 2021-09-22
    11 min

    10musume 092221_01 Secret Pussy Collection: Rei Hashimoto

  • amateur uncensored10musume
    • 2021-10-06
    136 min

    [GVH-295]Meet The S*****t Council Brats Who Group Fucked Their Hot Teacher And The Sexy PTA Chairwoman Honoka Kimura & Yuri Mizukawa

  • honoka kimura yuri mizukawa censoredbig titsGVHglory questhyonGVH-295GVH295gvh00295
    • 2021-10-08
    79 min

    300NTK-643 [W Beauty Bitch Summit Decisive Battle! !! Slender Vs Boyne’s W Bitch Dream Competition Gangbang! !! ] Supreme Vs Ultimate! !! Dochashiko Smashing Orgy 4p! !! Slender Gals And Rocket Milk Gals Of Course W Bitches! !! Betting The Pride

  • amateur censoredcreampieamateurntkntk-643ntk643300ntk-643
    • 2021-10-12
    480 min

    [KTRA-338]Sex with My Short, Lolita-Type Younger Stepsister, 10 Girls, 8 Hours, A Set of 2 DVDs

  • toua kotone risa kudo censoredcreampieKTRAk tribeKTRA-338KTRA338h-094ktra00338
    • 2021-11-04
    47 min

    [110421-001][VR] Amazing posture insertion technique

  • amateur uncensoredcreampiecaribbeancom
    • 2021-11-05
    138 min

    [DASD-936]A Deep Piston Fuck Making This Trendy Wife Cum Over And Over Again - Juri Mitani

  • mitani akari censoredcreampieblowjobDASDdaskonnyaku kannoDASD-936DASD936dasd00936
    • 2021-11-05
    162 min

    [FFFS-033]Bringing Mature Women! Married Women Playing With Other Men"s Cocks! All 30 Voyeur Documents - An Older, Sexually Frustrated Relative Who Commits Obscene Acts With Her Cute Nephew - Natsuki-san, G-cup, 38 Years Old, Auntie Natsue-san, H

  • censoredmature womanslutFFFSprivate mousozokugroupFFFS-033FFFS033fffs00033
    • 2021-11-05
    120 min

    [IPX-761]Obscene Nipple Nympo Nurses. With Dirty Talk and Nipple Probing, Her Painstaking Nipple Treatment Leads To Ultimate Ejaculation Tsubasa Amami

  • amami tsubasa censoredslutsingle workIPXidea pockettissueIPX-761IPX761ipx00761
    • 2021-11-12
    173 min

    [MIAA-528]100x More Pleasure Than A Sex Club!! A Men"s Massage Parlor Where You"ll Get Erotic Dirty Talk Whispered Into Your Ear While Your Dribble Pre-Cum All Over Her Tight, Pretty Ass As This Gal Slut Gives You So Much Nookie Your Brain Wi

  • tsukino luna censoredcreampieslutMIAAmoodyztorendei yamaguchiminna no kikatanMIAA-528MIAA528miaa00528
    • 2021-11-12
    124 min

    [TPPN-211]A Sure Thing! She"s Cum Down To Bless Us For The First Time! (A New Generation Sex Monster) Has Cum Down She"s Seeking The Upper Limit Of Pleasure As She Detonates Her Deep Desires For Passion! Deep And Rich Sex, Seeped In Sweat And

  • squid censoredblowjobhandjobTPPNteppanTPPN-211TPPN211tppn00211
    • 2021-11-25
    51 min

    413INST-186 [Reiwa Body Born In The 2000s] 3rd Term ▲ Personal Photo Session Called By Otaku Gonzo In Representative Song Costume Gonzo Private Vaginal Cum Shot Outflow [Pillow Party] (Kotome Himeno)

  • amateur censoredcreampieuniforminstinst-186inst186413inst-186
    • 2021-12-30
    125 min

    [AARM-048]The Masturbation Cheerleaders! A Sexy Masturbation Support Cheerleader Who Will Give You Instructions On How To Stroke Your Cock

  • kuraki bookmark misaki azusa censoredanalAARMaroma planningmania satoshiaromaAARM-048AARM048aarm00048
    • 2021-12-31
    161 min

    [JUFE-357]I"ll Show You My Bare Body And Seduce You! My Wife"s Best Friend Is A Female Announcer Who Loves To Nakadashi Nao Yuuri

  • yuuri nao censoredcreampiebig titsJUFEfitchmichiru arashiyamaJUFE-357JUFE357jufe00357
    • 2022-01-10
    240 min

    [016HEZ-370]淫乱母娘ナンパ やっぱり親子！恥らいイキまくり！！4時間SP 4

  • amateur censoredcreampieamateurhezhez-370hez370016hez-370
    • 2022-01-15
    109 min

    [OIGS-043]Forbidden Rope Training Of A Rope Addicted Married Woman And Her Former Lover Mako Oda

  • oda mako censoredbig titsbdsmOIGSavs collector susubashisuiavscollector sOIGS-043OIGS043oigs00043
    • 2022-01-22
    136 min

    [CEMD-114]One-only Anal Sex Is Back! Chisato Shoda - This Is The Last Time You"ll See Her! This Is The Last Time You"ll See A Legendary Actress Having Anal Sex!

  • shota chisato censoredanalbig titsCEMDceleb no tomoCEMD-114CEMD114cemd00114
    • 2022-01-28
    88 min

    573DHT-0359 [Innocent! A Cute Baby-Faced Female With A Smile Has Fallen! ] Nizokon! [Obvious Pubic Hair! Love Juice Dripping From The Pubic Area] Moe Kyun In The Erotic Gap! [Pure Innocence! Innocent Girl] Is An Adult Female Face! [Innocent Smile And

  • amateur censoredcreampieamateurdhtdht-0359dht0359573dht-0359
    • 2022-02-11
    248 min

    [SKMJ-254]Calling All The Prim, Proper, Beautiful Married Babes Out There! "Would You Let A Virgin Guy Who Was Nervous About Sex Thigh Fuck You In The Bath？" Erotic Wives Tenderly Turn On Shy Guys Then Things Get A Little More Slippery Than I

  • censoredcreampiebig titsSKMJblush girlyosukeSKMJ-254SKMJ254h-1324skmj00254



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi