uniform javcensored high vision jav




FC2CJODWANZAPODJUFEHDKAAUKGMVSDSTARSAUKSSDABVEMAPREDNACRPPPDDASDHNDWAAAFSDSSDTTHODV

2020-09-10
173 min

[NHDTB-435]This Sch**lgirl Has Been Thoroughly Initiated And Prepared For Aphrodisiac-Laced Pleasure And She's Been Fitted With A Vibrator In Her Panties To Wear To School, Where She'll Be Tied Up And Left For Hours While She Withstands The W

  • censoredbig titsschoolgirlNHDTBnatural highvanilla sakuraiNHDTB-435NHDTB4351nhdtb00435
    • 2020-09-10
    49 min

    [ZOZO-011]Shame! New S*****t Boy And Girl Education Health Exam 2020 - Kanon Edition

  • censoredcreampieZOZOsadistic villagesadieville emotionZOZO-011ZOZO0111zozo00011
    • 2020-09-10
    24 min

    [ZOZO-008]Shame! New S*****t Boy And Girl Education Health Exam 2020 - Sena Edition

  • censoredbeautiful girlZOZOsadistic villagesadieville emotionZOZO-008ZOZO0081zozo00008
    • 2020-09-10
    43 min

    [ZOZO-006]Shame! New S*****t Male And Female Mixer Growth And Physical Examination 2020 / Body Measurements - Vaccination Compilation

  • censoredbig titsZOZOsadistic villagesadieville emotionZOZO-006ZOZO0061zozo00006
    • 2020-09-10
    42 min

    [ZOZO-012]Shame! New S*****t Boy And Girl Education Health Exam 2020 - Hina Edition

  • censoredcreampiesquirtingZOZOsadistic villagesadieville emotionZOZO-012ZOZO0121zozo00012
    • 2020-09-10
    426 min

    [NHDTB-434]We Discovered This Tiny Girl At A Bookstore And Now She's Been Surrounded By A Filthy Big Dick Gang 20 Super Select Tiny And Adorable Mini-Sized Barely Legal Babes Cums With Highlights

  • censoredsquirtingNHDTBnatural highlemonheart nakajimaNHDTB-434NHDTB4341nhdtb00434
    • 2020-09-07
    145 min

    [DPSDL-011]This Little Stepsister Loves Her Big Stepbrother, And Now They're Meeting Up For The First Time In Years When She Suddenly Gave Him A French Kiss And Hugged Him And Begged Him For Sex, He Couldn't Resist, And Fucked Her Over And Ov

  • chiharu sakurai hikaru minazuki censoredcreampieuniformDPSDLdeep sDPSDL-011DPSDL011dpsdl00011
    • 2020-09-07
    160 min

    [DPSDL-010]Doting Stepsister Runs Her Tongue Over Her Stepbrother's Whole Body - He Acts Like He Doesn't Want It, But He's Rock Hard, And She Ends Up Taking His Virginity Cowgirl Style... And His Creampie!

  • mizuki yayoi mirei nitta censoreduniformsisterDPSDLdeep sDPSDL-010DPSDL010dpsdl00010
    • 2020-09-05
    237 min

    [HUNTA-845]"What？ Am I A Sadist？" "What？ I'm A Masochist？" The Hidden Sexual Hangups Of These Cute C***dhood Friends Are Finally Set Fre! My C***dhood Friend Is Putting The Moves On Me. And I'm Putting The Moves On My C***dho

  • censoredcreampieschoolgirlHUNTAhuntermorikihhh groupHUNTA-845HUNTA845hunta00845
    • 2020-09-05
    53 min

    [HHKL-062]S********l Working Part Time At A Supermarket Still In Her Uniform Innocently Flashes Her Panties And I'm So Horny I Could Explode!

  • censoredschoolgirlHHKLhunterkoichi davidsonhhh groupHHKL-062HHKL062hhkl00062
    • 2020-09-04
    42 min

    [ETQR-154](Daydream POV Sex) At This Reflexology Salon, You'll Be Serviced By A Little Stepsister Who Loves Her Big Stepbrother So Much, You'll Get To Fuck Her Brains Out Himari Hanazawa

  • himari kinoshita censoredcreampieuniformETQRerotic timeETQR-154ETQR154h-1186etqr00154
    • 2020-09-04
    44 min

    [ETQR-153](Daydream POV Sex) At This Reflexology Salon, You'll Be Serviced By A Little Stepsister Who Loves Her Big Stepbrother So Much, You'll Get To Fuck Her Brains Out Ichika Matsumoto

  • ichika matsumoto censoredcreampieuniformETQRerotic timeETQR-153ETQR153h-1186etqr00153
    • 2020-09-04
    233 min

    [DOCP-243]My Girlfriend's "Little Sister" Is A Little Devil Who Lured Me To Temptation...!？ My Girlfriend Is Right Nearby, But She Keep Hitting Me With Nonstop Whispering Dirty Talk

  • scooping aya chinen censoreduniformsisterDOCPprestigedoc premiumDOCP-243DOCP243118docp00243
    • 2020-09-04
    53 min

    [ETQR-155](Daydream POV Sex) At This Reflexology Salon, You'll Be Serviced By A Little Stepsister Who Loves Her Big Stepbrother So Much, You'll Get To Fuck Her Brains Out Shuri Atomi

  • atomi shuri censoredcreampieuniformETQRerotic timeETQR-155ETQR155h-1186etqr00155
    • 2020-09-04
    234 min

    [DOCP-244]This Excessively Beautiful Nurse Took Pity On Me Because I Could Not Engage In Masturbation, So She Said To Me, "We Need To Keep This A Secret..." And Secretly Mounted Me For A Cowgirl And Allowed Me To Creampie Her... But She Didn&

  • wakamiya mizukawa violet censoredcreampieuniformDOCPprestigedoc premiumDOCP-244DOCP244118docp00244
    • 2020-09-04
    120 min

    [ONEZ-254](Total POV) Lovey-Dovey Sex The Whole Time, And Then, Suddenly! She Agreed To Instant Dick-Sucking Quickie Sex! A Beautiful Girl Sailor Uniform Sex Club They Love Big Bros At This Image Club Himari Hanazawa vol. 001

  • himari kinoshita censoredcreampieuniformONEZprestigetodoonezONEZ-254ONEZ254118onez00254
    • 2020-09-04
    76 min

    [ETQR-158](Proper POV) Stepsister Who Is Madly In Love With Her Stepbrother's Huge Cock Nagi Aiiro

  • indigo nagi censoredcreampieuniformETQRerotic timeETQR-158ETQR158h-1186etqr00158
    • 2020-09-04
    115 min

    [ONEZ-253]Obedient Class Fuck, Nene Tanaka vol. 001

  • nene tanaka censoredcreampiebig titsONEZprestigetodoonezONEZ-253ONEZ253118onez00253
    • 2020-09-04
    60 min

    [ETQR-156](Daydream POV) Raw Creampie OK Sailor Uniform Beauty Massage Parlor Urara Kanon

  • hanaoto urara censoredcreampieuniformETQRerotic timeETQR-156ETQR156h-1186etqr00156
    • 2020-09-03
    119 min

    [AKDL-045]"Can I Record You And Dad Making Love... On Video？" This Young Stepdaughter And Her Honorable Stepfather Had Been Living Together For 6 Years When She Decided She Wanted To Make A Video Journal About Their Life Together Mizuki Yayoi

  • mizuki yayoi censoredschoolgirlsingle workAKDLakinorishurikenaknrAKDL-045AKDL0451akdl00045
    • 2020-08-29
    148 min

    [MIAA-291]A Double Beautiful Girl Domination This Orgasmic Old Man Got Remarried And Had Fun Without His Happy Wife's Knowledge Because He's Been Fucking Us The Whole Time Mitsuki Nagisa Yui Nagase

  • scooping yui nagase censoredcreampieuniformMIAAmoodyzham the mceveryone s porn starMIAA-291MIAA291miaa00291
    • 2020-08-28
    476 min

    [HRV-041]Sex With Clothed Office Ladies BEST HITS COLLECTION Vol.01 These Beautiful Hard-Working Office Ladies Are Losing Their Minds And Fucking Their Brains Out While Clothed 480 Minutes

  • maria aine ryo harusaki censoreduniformHRVprestigeharvestHRV-041HRV041118hrv00041
    • 2020-08-28
    131 min

    [DFE-045]Bedridden Throat Fuck, Nana Maeno

  • nana maeno censoredschoolgirldeepthroatDFEwaap entertainmentikkyu senfearlessDFE-045DFE0452dfe00045
    • 2020-08-28
    156 min

    [BANK-012]The Creampie Outdoor Hot Spring Bath A Secretly Horny Voluptuous 18-Year Old Girl With Big Areolas & Erect Nipples

  • censoredcreampiebig titsBANKpussy banktake chanBANK-012BANK012h-1495bank00012
    • 2020-08-28
    71 min

    [HYPN-029]専属奴●メイドはいかがですか？ みひな

  • yuki god censoreduniformsingle workHYPNsod createmorikawa keimind controlHYPN-029HYPN0291hypn00029
    • 2020-08-28
    241 min

    [SIM-087]Horny Female S*****ts Bring Their Slutty Friends In A Chain Of Pickups [Linking Creampies] Fucked Raw In Sexy Costumes Edition

  • censoredcreampiebig titsSIMprestigeamateur pussiesSIM-087SIM087118sim00087
    • 2020-08-28
    240 min

    [GIGL-618]I'm Cumming!! This Massage Lady Hasn't Been Getting Any In A While Hey There, You Want A Taste Of This Rock Hard Cock, Don't You, Don't You!？ 4 12 Ladies

  • censoreduniformamateurGIGLgigolo gigologigoloGIGL-618GIGL618h-860gigl00618
    • 2020-08-27
    180 min

    [SW-722]I'm About To Have Sex With A College Girl In Uniform Who's Bored Out Of Her Mind! I Was In The City And Picked Up On A Girl Who Seemed Bored, And She Said, Fine, I Can Spend Some Time With You! And Took The Bait So Easily, I Hooked My

  • censoredSWswitchswitch switchSW-722SW7221sw00722
    • 2020-08-27
    149 min

    [SVDVD-809]Shame! Outdoor Ass-Shattering Sex! A Super Amazing Big Bang Egg Vibrator Pussy Insertion Squirting Orgasmic Date! 17 Meet My Girlfriend Ichika Matsumoto

  • ichika matsumoto censoredcreampieamateurSVDVDsadistic villagetoranosukeSVDVD-809SVDVD8091svdvd00809
    • 2020-08-27
    323 min

    [SVDVD-813]New S*****t Initiation Health Exam 2020 -Middle of Summer-

  • censoredbig titsSVDVDsadistic villagenew kage kazamaSVDVD-813SVDVD8131svdvd00813
    • 2020-08-23
    112 min

    [AGAV-033]Little Demon Total Domain Girl. - Slut Urara Makes Masochist Guys Cum Huge Loads In 3 Scenes - Urara Kanon

  • hanaoto urara censoredbeautiful girlslutAGAVsex agent daydreamersspilma boysex agentAGAV-033AGAV033agav00033
    • 2020-08-23
    136 min

    [DBER-078]ULTRA HYPER JUICY AWABI A Cruelly And Publicly Shamed Celebrity Film-01: A Tragic Female Documentary!! A New Face Announcer Gets Shamed While On The Air Noa Kosaka

  • kosaka censoreduniformbdsmDBERbabyentertainmentkikubonred babeDBER-078DBER078dber00078
    • 2020-08-23
    144 min

    [SQTE-317]Are You Serious!？ A Girl Who Cums With Her Nipples - No Matter How Much You Lick Them, Suck Them, Or Pinch Them - Chiharu Miyazawa

  • chiharu miyazawa censoreduniformblowjobSQTEs cuteSQTE-317SQTE317sqte00317
    • 2020-08-22
    118 min

    [CAWD-108]Ferocious Wet Kiss, Cock Sucking, Anal Licking Face And Body Are Soaked With Saliva And Pussy Juice This Beautiful Y********l In Uniform Loves Mouth To Pussy Suzu Kiyomiya

  • kiyomiya suzu censoreduniformblowjobCAWDkawaiidragon nishikawaCAWD-108CAWD108cawd00108
    • 2020-08-22
    188 min

    [HND-872]Sweet Innocent Creampie Love - From The Day We First Began Dating, When We Kept Missing Each Other, Today, After 3 Long Years, We Finally Have Raw Creampie Sex - Rei Kuruki

  • satoshi kuruki censoredcreampieuniformHNDhon nakabacon tanakaHND-872HND872hnd00872
    • 2020-08-22
    118 min

    [HND-871]That Day, This Creepy Old Man Made A Promise To A Slender Beautiful Y********l In Uniform That He Wouldn't Cum Inside Her, But Right Before He Ejaculated, He Squirted His Cum Into Her, Over And Over Again Ichika Matsumoto

  • ichika matsumoto censoredcreampieuniformHNDhon nakahiroaHND-871HND871hnd00871
    • 2020-08-21
    127 min

    [SHIC-186]My New Wife's Daughter Sara-chan Director's Cut Final Edition

  • censoredcreampieuniformSHICadolscence.comSHIC-186SHIC186h-839shic00186
    • 2020-08-16
    121 min

    [ONIN-051]This Girl In A Blouse Uniform Is Wearing Tiny Cotton Panties That Are Digging Into Her Voluptuously Massive Ass! And She's Keeping Her Panties On While You Pump Her With Your Cock!

  • censoreduniformONINtamanegi mousouzokudoryu barrymoretamanegiONIN-051ONIN051onin00051
    • 2020-08-16
    136 min

    [MKON-035]I Loved My C***dhood Friend But This Super Strong Exchange S*****t Fucked Her Instead Hikaru Minazuki

  • hikaru minazuki censoredcreampieuniformMKONkaguyahimept mousouzokuichiro yumisakimikonMKON-035MKON035mkon00035
    • 2020-08-15
    119 min

    [SSNI-848]This Girl Doesn't Look She Knows Anything About Sex But She'll Service You With A Smile And Give You All Sorts Of Secret Optional Frills Without Asking For Permission In This Absolutely Satisfaction Guaranteed Uniform Reflexology Sa

  • yura kanno censoreduniformbeautiful girlSSNIs1 no 1 stylezaku araiSSNI-848SSNI848ssni00848
    • 2020-08-15
    117 min

    [SSNI-834]I Was Stranded With My S*****t During A Sudden Rainstorm, So We Warmed Our Drenched Bodies And Engaged In Sweaty Fucking Sex, Over And Over Again, That Stormy Night Hiyori Yoshioka

  • hiyori yoshioka censoreduniformbeautiful girlSSNIs1 no 1 stylemametaro mamezawaSSNI-834SSNI834ssni00834
    • 2020-08-14
    128 min

    [ZMEN-060]My Little Stepsister Is A Nurse Who Blatantly Prances Around Me With Her Guard Down And When I Could No Longer Resist, I Fucked Her...

  • aoi kururugi from nishikura censoreduniformsisterZMENz mengoro koenjiZMEN-060ZMEN060h-1371zmen00060
    • 2020-08-14
    147 min

    [ZMEN-062]My Gal Little Stepsister Was Absolutely Determined To Get Her Playboy Boyfriend To Compliment Her On Her Sexual Abilities, So She Decided To Practice Her Blowjob Technique On Me Every Day!？ While She Kept On Sucking On My Cock, And Making I

  • eternal love is it censoreduniformschoolgirlZMENz menbieber gonzoZMEN-062ZMEN062h-1371zmen00062
    • 2020-08-14
    139 min

    [SABA-640]Sharing A Hotel Room With My Coworker After We Went Out And Missed The Last Train... She Seemed So Unguarded, I Couldn't Resist Her... vol. 003

  • censoredcreampieuniformSABAskyu shirototodoSABA-640SABA640h-244saba00640
    • 2020-08-14
    224 min

    [XRW-905]Throat Fuck Creampie Hottie Training Deep Throat Shiori Mochida

  • yuri mochida censoreduniformdeepthroatXRWreal worksani nakamurareal real worksXRW-905XRW905172xrw00905
    • 2020-08-14
    154 min

    [SABA-641]Welcome, All You Cherry Boy Losers!! A Super Talented Office Lady Takes On The "Challenge The Mission" Game! First It's A Titty-Rubbing Handjob & A Titty Hug! Then It's Time For A Bashful Pussy Grinding When His Dick Pops

  • censoredbig titsuniformSABAskyu shirototodoSABA-641SABA641h-244saba00641
    • 2020-08-14
    234 min

    [DOCP-239]"Seriously, Is She An Angel!？" I Was In The Hospital With Broken Bones And Couldn't Enjoy My Usual Masturbation, And Now My Cock Was At Its Limit! When This Beautiful Nurse Saw Me, She Felt It Was Her Mission To Care For Me, And

  • yumemi teruuta yui kawai censoredcreampieuniformDOCPprestigedoc premiumDOCP-239DOCP239118docp00239
    • 2020-08-14
    235 min

    [MDTM-657]Super Horny Girls from an Elite Girls School Show Us Their True Colors 09

  • remi hayami yamamoto renka censoredcreampieuniformMDTMuchu kikakutetMDTM-657MDTM657h-585mdtm00657
    • 2020-08-14
    150 min

    [BANK-011]The Creampie Outdoor Hot Spring Bath She's Been Selected To The SLUT JAPAN National Team! A Tall And Horny Elder Sister Type With An Excessively Erotic Body And Beautiful Legs

  • censoredcreampieuniformBANKpussy banktake chanBANK-011BANK011h-1495bank00011
    • 2020-08-14
    145 min

    [ZMEN-061]When My Live-In Girlfriend Was Away On Vacation For 3 Days, I Started Having Quickie Sex With The Pretty Coworker Lady At My Part-Time Job During Our Breaks 2

  • kamisaki mai miyoshi nagi censoreduniformZMENz mennaveZMEN-061ZMEN061h-1371zmen00061
    • 2020-08-14
    197 min

    [BAZX-244]I Had Serious Fuck Fest Sex With A Lactic Acid D***k Sales Lady That I Would Always See Around My Neighborhood vol. 004

  • censoredcreampieuniformBAZXbazookatodoBAZX-244BAZX244h-1496bazx00244
    • 2020-08-13
    122 min

    [FGAN-022]Panty Fetish Lovers Group Shizuku - Shizuku Asahi

  • asahi drop censoredsingle workFGANfetish eyesFGAN-022FGAN022h-1440fgan00022
    • 2020-08-13
    154 min

    [NHDTB-426]Tied Up With Her Legs Spread Furious Orgasmic Squirting 3 This J* Model Was Pumped Full Of Aphrodisiacs Until She Went Insane And Lost Her Mind In Consecutive Ejaculation Ecstasy

  • censoredsquirtingschoolgirlNHDTBnatural highvanilla sakuraiNHDTB-426NHDTB4261nhdtb00426
    • 2020-08-13
    177 min

    [SW-719]A Youthful Offline Fuck With A S********l Who Loves Sex That He Met On Social Media 5

  • censoreduniformschoolgirlSWswitchswitch switchSW-719SW7191sw00719
    • 2020-08-13
    119 min

    [FSDSS-080]Kaname Momojiri's Life In The Loving Sex School

  • kaname momojiri censoredschoolgirlblowjobFSDSSfalenokyoseifaleno starFSDSS-080FSDSS0801fsdss00080
    • 2020-08-13
    225 min

    [SVDVD-806]This Girl Who Goes To A Young Ladies' School Was Deceived At What She Thought Was An Idol Audition! This Country Girl Came To Tokyo Wearing Her Uniform And Harboring Big Dreams, But Instead They Were Torn To Shreds In Sexual Degradatio

  • censoredcreampiebig titsSVDVDsadistic villagetrendy yamaguchiSVDVD-806SVDVD8061svdvd00806



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi