uniform javcensored jav censored high vision




FC2MILKGVHCHRVCAWDHMNATIDGMEMMIDVIPXSPRDPPPDDASDNACXVEMAMEYDEBODSQTESHKDCESDLULU

2018-02-23
134 min

[AKA-055]A Beautiful Amateur In Uniform 13 A Prim And Proper Big Tits Receptionist Gets 20 Rich And Thick Cum Shots Of Semen Splattered Onto Her This Receptionist At A Famous Department Store Is Getting Her Beautiful Face And Tits Defiled With Drippy

  • censoredbig titsamateurAKAprestigemichiru sanakama mushiAKA-055AKA055118aka00055
    • 2018-02-16
    129 min

    [KTKL-027]The Popular Little Sister Cafe In Ikebukuro The No.1 And Most Popular Barely Legal We Negotiated For Some Secret Optional Services A Secret AV Debut

  • censoredcreampieschoolgirlKTKLkitixx mousouzokuloliconKTKL-027KTKL027ktkl00027
    • 2018-02-16
    244 min

    [HUNTA-412]My Childhood Friend Felt Sorry For Me, So She Decided To Let Me Practice Sex By Hot Dogging Me! And That's All It Was Supposed To Be! Me And My Childhood Friend Were Always Together Since We Were Little Kids, But Now She's Become A

  • censoredschoolgirlHUNTAhunterkawajirihhh groupHUNTA-412HUNTA412hunta00412
    • 2018-02-16
    240 min

    [GDHH-092]No Matter How Old She Gets, My Innocent Childhood Friend Likes To Play Pranks (Wrestling, Gas Pedaling My Balls, etc) On Me, And It Gets Really Rock Hard!!! Before I Knew It, She Was The Most Popular Girl In Class, And I Became A Wallflower

  • censoredschoolgirlGDHHgolden timerobby kunhhh groupGDHH-092GDHH092gdhh00092
    • 2018-02-11
    135 min

    [APNS-045]These Two Are Best Friends... They Only Want The Best For Each Other, And Here Cums A Dirty Bastard Who Shits All Over Their Good Feelings... Aoi Mukai Nami Sekine

  • ai mukai nami sekine censoreddramaAPNSaurora project annexnasu yukihiroAPNS-045APNS045apns00045
    • 2018-02-11
    115 min

    [APKH-056]Uniform Real Sex Doll I'm Getting Rich And Thick Semen All Over My Face And Pussy... And I'm Speechless... Mio Hirose

  • hirose mio censoredcreampiesingle workAPKHaurora project annexaurora project anexAPKH-056APKH056apkh00056
    • 2018-02-10
    181 min

    [HNDS-055]Lucky Creampie My Adolescent Little Sister And Her Friends Came Over To Spend The Night And They All Told Me That They Loved Me, So Fucked Them Raw

  • shiina sky real village henan censoreduniformbeautiful girlHNDShonnakazampahon nakaHNDS-055HNDS055hnds00055
    • 2018-02-10
    119 min

    [MIAE-182]Shining Thick Thighs Penetration Slender Knee High Beautiful Girl - Akari Mitani

  • mitani akari censoredsingle workMIAEmoodyzzampamoodyz acidMIAE-182MIAE182miae00182
    • 2018-02-09
    121 min

    [SABA-377]# Creampie Raw Footage Runaway Beautiful Young Girl In Uniform 002 Kaede

  • censoredcreampieamateurSABAskyu shirototodoSABA-377SABA377h-244saba00377
    • 2018-02-09
    221 min

    [SCPX-251]My Childhood Friend Is A Virgin, And I'm A Cherry Boy We're So Sweet And Innocent, But Now We're Bashfully Practicing To Have Sex! I Was Grinding My Cock Against Her Pussy, But It Was So Wet And Dripping That It Just Slipped Rig

  • censoredcreampieschoolgirlSCPXscoopyosukemousouzokuSCPX-251SCPX251h-565scpx00251
    • 2018-02-09
    199 min

    [BAZX-115]"I Wanna Fuck This Girl..." VOL.009 I Couldn't Control My Hard On For This Neat And Clean Beautiful Girl In Uniform So I Had To Assault Her

  • censoredcreampieamateurBAZXmedia stationtodobazookaBAZX-115BAZX11561bazx00115
    • 2018-02-02
    120 min

    [ONEZ-122]#Tokyo Raw Creampie Pussy Pounding Gal In Uniform Vol.002 Shino Saijo

  • saijo censoredcreampiebig titsONEZprestigeonezONEZ-122ONEZ122118onez00122
    • 2018-02-02
    242 min

    [WSP-132]Fully Clothed Sex With A Beautiful Young Girl In Uniform

  • chika sakaegawa noa censoredschoolgirlWSPwaap entertainmentsWSP-132WSP1322wsp00132
    • 2018-02-02
    121 min

    [DIC-006]Suzume No.3 Rina/Mai

  • censoredschoolgirlamateurDICdickyDIC-006DIC00636dic00006
    • 2018-02-01
    117 min

    [AMBI-087]The School Committee Chairperson Was Modest - Ai Hoshina

  • sena ai censoredcreampieuniformAMBIplanet plusbirdman teppeiAMBI-087AMBI087h-237ambi00087
    • 2018-01-28
    126 min

    [SQTE-200]Mikako Abe x S-Cute Natural Bodies Cute Sex

  • abe mikako censoredbeautiful girlsingle workSQTEs cuteSQTE-200SQTE200sqte00200
    • 2018-01-26
    483 min

    [TRE-062]Beautiful Young Girl in Uniform School Days Sex Special A Sexy And Bittersweet Virtual Experience With 18 Hot And Popular Student Babes

  • censoredbeautiful girlTREprestigetreasureTRE-062TRE062118tre00062
    • 2018-01-25
    141 min

    [BDSR-327]*Bonus With Streaming Editions* From 10:00 a.m. to 03:00 p.m., It's Fuck Time! Amateurs Only I Just Had Creampie Sex With A Delivery Men's Massage Parlor Peeping Big Tits Married Woman Therapist

  • censoreduniformBDSRbig morkaljiro kanekobigmorkalBDSR-327BDSR32757bdsr00327
    • 2018-01-19
    130 min

    [DIV-244]J Slick Pussy Dildo Masturbation 8

  • kimiiro kanon ai rui censoredschoolgirlDIVoffice k sdont knowdiva sDIV-244DIV24436div00244
    • 2018-01-12
    120 min

    [MDTM-321]Raw Orgasmic Creampie Sex With A Shaved Pussy Girl With Massive Bovine Tits Since She Didn't Seem To Know Much About Protection, I Came Inside Her

  • censoredcreampiebig titsMDTMmedia stationuchu kikakuMDTM-321MDTM32161mdtm00321
    • 2018-01-11
    225 min

    [NHDTB-078]A Big Tits Schoolgirl In Uniform Gets Groped And Grabbed From Behind And Wiggles Her Ass On A Crowded Bus By A Titty Grabbing Molester 3

  • censoredbig titsschoolgirlNHDTBnatural highjanken kotamaNHDTB-078NHDTB0781nhdtb00078
    • 2018-01-11
    156 min

    [STAR-865]An SOD Star Ann MIta All Cum Face All The Time! A Massive Incest Family A Six Way Orgy She's Got A Fresh And Hot Body And Having Sex With The Family Until She Loses Her Mind!!

  • miharu kawada anri mita censoredschoolgirlsisterSTARsod createzampasod starSTAR-865STAR8651star00865
    • 2018-01-08
    130 min

    [APKH-054]Sticky And Dripping Humid Sex With A Girl In Uniform Under The Futon This Meat Eating Beautiful Girl With Fair Skin And Banging Beautiful Tits And Nasty Pussy Hair Is Getting Busy For Nookie Action Enjoy As She Descends Into Lusty Semen-Fil

  • hinata clan censoredcreampieschoolgirlAPKHaurora project annexaurora project anexAPKH-054APKH054apkh00054
    • 2018-01-05
    145 min

    [DOCP-011]I Couldn't Control The Thrill I Felt From The Total Domain Peeking Out From Underneath Her Miniskirt...

  • censoredamateurDOCPprestigedoc premiumDOCP-011DOCP011118docp00011
    • 2018-01-05
    134 min

    [AKA-053]A Beautiful Amateur In Uniform 11 A Bitchy Office Lady Gets He Pride Dragged Through The Sludge Of 16 Rich And Thick Semen Cum Shots

  • censoredbig titsuniformAKAprestigemichiru sanakama mushiAKA-053AKA053118aka00053
    • 2017-12-31
    244 min

    [HUNTA-391]Hunter x Apache x Golden Time Triple H Group A 3 Label Variety Collaboration These Girls Were Molested By A Molester On Their Way To School, And Right After Getting To Class They Erupted In Horny Lust! I Was The Only Boy At This Commercial

  • censoredschoolgirlHUNTAhunterkawajirihhh groupHUNTA-391HUNTA391hunta00391
    • 2017-12-23
    110 min

    [MUKD-440]A Divinely Small Waist And A Nice Round Ass

  • censoredcreampiebeautiful girlMUKDmukuMUKD-440MUKD440mukd00440
    • 2017-12-22
    200 min

    [BAZX-102]"I Want To Fuck This Girl..." VOL.007 When A Prim And Proper Private Schoolgirl Gets Defiled And Degraded Into A Sex-Addicted Horny Slut

  • censoredcreampieschoolgirlBAZXk m producetodoBAZX-102BAZX10261bazx00102
    • 2017-12-22
    151 min

    [MDTM-313]An Obedient Schoolgirl Who Wants To Be Toyed With By Men A Seriously Cute Beautiful Girl In Creampie Raw Footage Maya Hasegawa

  • maya hasegawa censoredcreampieschoolgirlMDTMk m produceani nakamuraMDTM-313MDTM31361mdtm00313
    • 2017-12-22
    72 min

    [ETQR-018]Creampie Raw Footage OK Sailor Uniform Beautiful Girl Reflexology -Ai Hoshina

  • censoredcreampieschoolgirlETQRerotic timeETQR-018ETQR018h-1186etqr00018
    • 2017-12-22
    120 min

    [XRW-414]A No Panty Topless Schoolgirl

  • censoredbig titsschoolgirlXRWreal worksreal real worksXRW-414XRW414172xrw00414
    • 2017-12-21
    129 min

    [IENE-845]Akari Mitani A Newly Wed Lifestyle Between A Teacher And Student

  • mitani akari censoredschoolgirlsingle workIENEie nergykiku rinIENE-845IENE8451iene00845
    • 2017-12-21
    166 min

    [NHDTB-074]This Lady At Work Accused Me Of Crimes And Insulted Me, So Now I'm Making 3 New Demands Of Apology In This Special! "Spread Eagle Pussy Atonement" "A Dildo Apology" "Ass Baring Reparations" Rape Them, Stare At

  • censoreduniformblowjobNHDTBnatural highpeyangumakiNHDTB-074NHDTB0741nhdtb00074
    • 2017-12-17
    243 min

    [HUNTA-389]Do Girls Drop Their Guard Underneath The Foot Warmer？ It Was Panty Shot Heaven! One Cold Day, My Little Sister Brought Her Friends Over They All Huddled Together In The Foot Warmer Doing Their Homework, And I Decided To Take A Peek. And I

  • censoredschoolgirlsisterHUNTAhunterkawajiriHUNTA-389HUNTA389hunta00389
    • 2017-12-09
    142 min

    [MRXD-071]A Perverted Maso Barely Legal Who's Hooked On Deep And Rich Sex With Dirty Old Men Please Teach Me How To Fuck I Want To Learn More, Much More Ai Hoshina

  • sena ai censoredbeautiful girlsingle workMRXDmarukusu kyoudaiarashiyama michiruMRXD-071MRXD071mrxd00071
    • 2017-12-09
    117 min

    [SSNI-068]A Devilish Little Sister Will Make Your Daydream Fantasies Cum True In A Sure Thing Erotic Situation Miharu Usa

  • miharu hanasaki censoredbig titsbeautiful girlSSNIs1 no 1 stylekyouseiSSNI-068SSNI068ssni00068
    • 2017-12-08
    122 min

    [SABA-351]Creampie Embargo Lifted An Honor Student Who's Gotten A Taste Of After School Sex

  • censoredcreampieschoolgirlSABAs kyuu shiroutoupdatingSABA-351SABA351h-244saba00351
    • 2017-12-08
    140 min

    [MDS-879]Beautiful Class Representative's Erotic Creampie Miyu Amano

  • miyu amano censoredcreampiebig titsMDSk m producewiruchinchinMDS-879MDS87961mds00879
    • 2017-12-08
    123 min

    [FSTD-003]No Parents, No Husband An 18 Year Old H Cup Full Term Pregnant Girl, Sayaka She Looks Just Like *na *koma From No**zaka 46 And Now She's Appearing In This AV In Order To Pay For Her Childbirth

  • censoredcreampiebig titsFSTDfirst starupdatingFSTD-003FSTD003h-491fstd00003
    • 2017-12-08
    134 min

    [AKA-050]Amateur Beauties In Uniform 10 Arrogant Bitchy Office Ladies With Beautiful Legs Are Having Multiple Hardcore Fucks Hard Enough To Shatter Their Pride!

  • censoredamateurbukkakeAKAprestigemichiru sanAKA-050AKA050118aka00050
    • 2017-12-08
    120 min

    [SABA-352]"I Was Raped By Smelly Dirty Old Men..." This Young Shaved Pussy Honor Student Was Held Down And Forced To Accept Rock Hard Cocks Shoved Into Her Pussy Meet 3 Schoolgirl Babes Who Were Assaulted By The Out-Of-Control Libidos Of Roug

  • censoredsquirtingschoolgirlSABAskyu shirotoSABA-352SABA352h-244saba00352
    • 2017-12-08
    178 min

    [MDB-836]I Have A Massive Cock, And I Was Wondering What Would Happen If I Was Admitted As A Patient To A Hospital Filled With Beautiful Female Doctor Babes... Yuri Oshikawa Kokone Mizutani Lea Kashii Rino Kirishima

  • yuri sugawa mizutani heart sound rio fujisaki censoredcreampieuniformMDBk m producegory matsudaMDB-836MDB83661mdb00836
    • 2017-12-08
    170 min

    [SCOP-478]We Heard That There Was A Lusty Slut Massage Parlor Therapist Who Would Oil Her Own Body Up And Check Out How Her Male Customers Would React And Shake Her Ass Like A Horny Bitch, So We Decided To Go Undercover And Check It Out!!

  • censoredcreampiebig titsSCOPk m producewiruchinchinSCOP-478SCOP478h-565scop00478
    • 2017-12-07
    139 min

    [STAR-850]Masami Ichikawa Romantic Lovey Dovey Thrills Of Youth And Daydream School Cosplay Sex Fantasies

  • masami ichikawa censoredschoolgirlsingle workSTARsod createichinose kurumiSTAR-850STAR8501star00850
    • 2017-12-07
    162 min

    [MANE-010]A Total Maso Man Domination School Life An Ultra Sadistic Classmate Is Breaking In A Schoolboy To Transform Him Into Her Kind Of Maso Slave Noa Eikawa

  • sakaegawa noa censoredsingle workMANEakinorishurikenMANE-010MANE0101mane00010
    • 2017-12-03
    194 min

    [OYC-148]We Are Weak-Willed Girls And Don't Have The Courage To Turn Down Any Requests We Cannot Refuse Anyone, So We Obey Whatever These Motherfuckers Say And Are Forced Into Creampie Sex Over And Over Again And Of Course, We Haven't Been Ab

  • censoredschoolgirlOYCoyashoku.companymatildahhh groupOYC-148OYC148oyc00148
    • 2017-11-24
    239 min

    [HONB-041]Huge Gang Bang - Four Hours

  • censoredHONBmercurythe first shibuya special force headquarHONB-041HONB041h-1133honb00041
    • 2017-11-24
    125 min

    [MDTM-303]Little Black Cat Maya Will Repay Your Kindness (With Sex) Maya Misaki

  • maya misaki censoredcreampiesquirtingMDTMmedia stationjozu tokonomauchu kikakuMDTM-303MDTM30361mdtm00303
    • 2017-11-24
    134 min

    [HCM-008]"A Divine Development!!" 3 We Just Happened To Encounter "The Moment Your Eyes Get Captivated" And If Something Were To Happen Afterward...

  • uehara hanakoi ichihara yume censoredbig titsuniformHCMprestigeupdatingHCM-008HCM008118hcm00008
    • 2017-11-24
    118 min

    [MDTM-298]All New After School Beautiful Girl Rejuvenating Reflexology + Vol.006 Seiran Igarashi

  • seirang igarashi censoredcreampieuniformMDTMk m producetodoMDTM-298MDTM29861mdtm00298
    • 2017-11-23
    110 min

    [MUKD-437]This Schoolgirl Says, I Like the Cowgirl Position, And As Soon As She Slips His Cock In For A Cowgirl, She Starts Shaking Her Ass Like A Totally Different Person, And Keeps Cumming Over And Over In Cowgirl Creampie Ecstasy

  • censoredcreampieschoolgirlMUKDmukuupdatingMUKD-437MUKD437mukd00437
    • 2017-11-23
    110 min

    [MUKD-436]A Tiny Titty Schoolgirl With A Small Waist Is Begging For A Backdoor Creampie Kanon

  • censoredcreampieschoolgirlMUKDmukuupdatingMUKD-436MUKD436mukd00436
    • 2017-11-23
    147 min

    [MUDR-026]Please Fuck My Daughter A Father's Lust Is Fueled When He Watches His Beloved Daughter Get Fucked By His Boss Mio Oshima

  • mio oshima censoredcreampieschoolgirlMUDRmukuMUDR-026MUDR026mudr00026
    • 2017-11-21
    122 min

    [KTR-020]Private Date with a Slender Beauty in Uniform Mayu Sato

  • mayu saito censoredbeautiful girlsingle workKTRk tribeKTR-020KTR020h-094ktr00020
    • 2017-11-19
    141 min

    [XVSR-299]A Serious Battle!？ If You Win This Sexy Challenge You Can Have Creampie Raw Footage Sex With Haruka Namiki!!

  • namiki haruka censoredcreampiesquirtingXVSRmax ashanthi yazawaXVSR-299XVSR299xvsr00299
    • 2017-11-19
    150 min

    [APKH-051]A Beautiful Young Girl In Uniform And Cultural Club President Who Is Possessed With Daydream Fantasies Of Sex Yayoi Amane

  • amane yayoi censoredcreampieschoolgirlAPKHaurora project annexupdatingAPKH-051APKH051apkh00051



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi