variety other fetishes javcensored censored def




FC2MEYDSTARSAMBIIPXGVHCAWDAUKGAPODAWDNACRSQTEDASDMILKFSDSSHDKAVENUCJODCESDROYDMVSD

2020-12-21
153 min

[FCDC-125]This Alluring Secretary Has Erect Nipples And A Small Waist And Likes To Lure The Employees To Temptation Because, After All, She's A Horny Slut Hotaru Mori

  • hotaru mori censoredslutsingle workFCDCweekenderFCDC-125FCDC125fcdc00125
    • 2020-12-21
    151 min

    [APKH-158]Beautiful Girl In Uniform Is A Secretly A Freaky Slut! Filthy POV Footage - Cum From A Spectacular Blowjob! She Cums Hard On Cock, And Will Stick Her Tongue In Your Anal Hole! Narumi Hirose

  • narumi hirose censoredcreampieschoolgirlAPKHaurora project annexhaurora project anexAPKH-158APKH158apkh00158
    • 2020-12-26
    61 min

    C0930 ki201227 Sayako Nakaji 32years old

  • amateur uncensoredc0930
    • 2020-12-31
    121 min

    [NDRA-083]My Wife Became A Whore For My Neighbor 32 Ayumi Kimito

  • kimi and ayumi censoredmature womansingle workNDRAjet eizomanji groupNDRA-083NDRA083ndra00083
    • 2021-01-07
    118 min

    [AKDL-076](Amateur + Big Tits) Young Dental Assistant With Superbly Sensitive H-Cup Tits - Touching Her Nipples Makes Her Cum Hard Ayase

  • censoredbig titsamateurAKDLaquinoristickaknrAKDL-076AKDL0761akdl00076
    • 2021-01-08
    43 min

    FC2PPV 1637222 [Complete appearance → It’s really dangerous if it gets caught] First 3P ☆ 2 consecutive vaginal cum shot! Ashi ○ Resident Piano Instructor J 〇 Clothes & Black Pantyhose Clothes ❤ Veranda Raw Saddle Desperately Pant Voice Gama

  • amateur uncensoredfc2
    • 2021-01-09
    402 min

    [KRU-103]Unreal Daydream Drama - Your Wish Has Come True! - "Time Stop!" - What Would You Do If You Could Stop Time？ - The Most Popular Girl In School And Your Beautiful Female Teacher Are Yours For The Taking! - Break Into School For Some Ti

  • censoredcreampiebig titsKRUkarmamanji groupKRU-103KRU103kru00103
    • 2021-01-10
    151 min

    [CHRV-123]The Maso Equation Maso Horny Areolas + Masso Nipples = Maso Titties I Love My Sadistic Big Stepbrother! This Little Stepsister Has Colossal Tits Worth More Than Just A Single Look And Proves It With Her Boobs! K-Cup 119cm Titties Yurippe

  • censoredcreampiebig titsCHRVcherry revolution daydream tribecherry s reboCHRV-123CHRV123chrv00123
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-22
    34 min

    [BTH-108]School Rules: Mandatory Deep Throat Blowjobs Yurika Miyaji

  • yuri miyachi censoredBTHchobitchchovicBTH-108BTH108h-1435bth00108
    • 2021-01-29
    301 min

    [SUPA-565]謹賀新年！！今年もたくさんヌかせます！！美女詰め合わせSS級福袋！！2021年お年玉ベスト

  • censoredcreampiebig titsSUPAs kyuu shiroutok tarouSUPA-565SUPA565h-244supa00565
    • 2021-02-06
    77 min

    300MAAN-623 [If you take it off, it’s amazing No1 x pure white G milk x obscene costume sexual intercourse] Youthful big breasts layer is disturbed by erotic cute & metamorphosis costumes! Thoroughly massage the marshmallow boobs! It’s

  • amateur censoredcreampiebig titsmaanmaan-623maan623300maan-623
    • 2021-02-12
    43 min

    [CLO-125]Lewd Kissing, Almost Like Intercourse Riko Honda

  • honda censoredblowjobmature womanCLOchobitchchovicCLO-125CLO125h-1435clo00125
    • 2021-02-18
    119 min

    [OKSN-319]Married Masochists With Hairy Pussy - Bound For Pleasure On An Adultery Trip - The Sky's The Limit For Ecstasy

  • censoredOKSNabc mousouzokuokasan.comOKSN-319OKSN319oksn00319
    • 2021-02-21
    25 min

    FC2PPV 1696192 [First shot] Creampie for a 20-year-old Russian blonde married woman “I regret a little because I got married young. You, please forgive me.” [Personal shooting] With high-quality ZIP

  • amateur uncensoredfc2
    • 2021-02-21
    138 min

    [JUL-457]Madonna Exclusive, 4th ANniversary - Momoko Isshiki's First Bondage Work - A Married Woman Drowning In Hemp Rope

  • momoko isshiki censoredmature womanbdsmJULmadonnakaiJUL-457JUL457jul00457
    • 2021-03-08
    52 min

    492MERC-242 The teacher has already quit …

  • amateur censoredbig titsuniformmercmerc-242merc242492merc-242
    • 2021-03-13
    127 min

    [ICIG-001]Barely Legal Amateur Girl 1: Minami #Tiny Tits #Skinny Ribs #Tender Nipples #Wannabe Idol's Secret Sugar Baby Lifestyle Filmed In POV

  • censoredamateurbeautiful girlICIGstrawberry opportunities the daydreammatakichi sarukichiICIG-001ICIG001icig00001
    • 2021-03-27
    241 min

    [SGSR-276]A Secret Store？! These Adorable Girls Will Go Home With You - To Hotels For Creampie Sex - You And Cum On Their Tits And Tongues 4-Hour Special

  • censoredcreampieamateurSGSRbig morkaleigyochuushinsengumiSGSR-276SGSR27657sgsr00276
    • 2021-03-30
    137 min

    [SDJS-115]Assistant Director Rui Komatsu, Age 22, Wanted To Be An Idol When She Was A S*****t, And She Lets Her Carnal Instincts Go Wild When She Fucks! She Went To A Women's College So She Seems Pure, But She Gets Up To All Kinds Of Naughty Thou

  • komatsu rui censoredsingle workSDJSsod createakira saijosod female employeeSDJS-115SDJS1151sdjs00115
    • 2021-04-06
    51 min

    FC2PPV 1753182 Mosaic collapse version ❤️ Red Mega Bank woman ❤️ Call on the way home from yoga soggy oil blame ❤️ Purchase privilege available

  • amateur uncensoredfc2
    • 2021-04-19
    58 min

    SIRO-4490 [First shot] [Unfussy girl] [In a straightforward voice ..] A freeter girl with an unfussy tone applied to buy a car. She was nervous and tended to look down .. AV application on the net → AV experience shooting 1511

  • amateur censoredamateursirosiro-4490siro4490siro-4490
    • 2021-04-28
    51 min

    FC2PPV 1792607 A fresh slender girl who just came to Tokyo ❤️ First and last intense Gonzo video [Personal shooting]

  • amateur uncensoredfc2
    • 2021-04-29
    74 min

    476MLA-036 [Back customs x slimy god massage] Narrow vagina slender beauty squeezes 4! Body cream sale in the daytime ⇒ Oil massage of meat stick at night ☆ Pleasure service immediately gin erection! Creampie SEX that tightens the vagina from Kyun Ky

  • amateur censoredcreampiesquirtingmlamla-036mla036476mla-036
    • 2021-05-01
    243 min

    [NACX-077]60 Mature Woman Babes Who Continue To Shake Their Asses During Cowgirl Sex vol. 02

  • kaho shibuya narumiya harua censoredbig titsmature womanNACXplanet plusnanakuruNACX-077NACX077h-237nacx00077
    • 2021-05-06
    19 min

    HEYZO 2516 A Titty Fuck with Rena – Rena Sanka

  • rena sanka uncensoredblowjobcumshotheyzo
    • 2021-05-07
    155 min

    [FSDSS-224]Hot And Steamy Sex Licking Up An Unfortunate Beautiful Y********l's Sweat And Guiding Her To A World Of Pleasure Noa Miura

  • miura noai censoredbig titsbeautiful girlFSDSSfalenonasty sanchezfaleno starFSDSS-224FSDSS2241fsdss00224
    • 2021-05-15
    134 min

    [KAGN-004]Amateur Girls Being Made To Suck Cock Wherever You Want 2 Two Friends Double Blowjob Version 14 Girls

  • censoredamateurblowjobKAGNkaguyahimept mousouzokuokina tsumadorinoprincess kaguya ptKAGN-004KAGN004kagn00004
    • 2021-05-21
    82 min

    230OREC-769 Hina

  • amateur censoredamateurbeautiful girlorecorec-769orec769230orec-769
    • 2021-06-05
    92 min

    [SCR-272]Record Of Dark Activities: Following A College Girl Who Lives Alone And Having Rough Sex With Her

  • censoredcreampiedeepthroatSCRglay zs crimeSCR-272SCR27212scr00272
    • 2021-06-15
    67 min

    10musume 061521_01 A beautiful aromatherapy instructor healed my heart and dick Nao Furuta

  • amateur uncensored10musume
    • 2021-06-17
    180 min

    [ABW-106]中出し やりたい放題 9 結城るみな 【MGSだけのおまけ映像付き 15分】

  • amateur censoredcreampieamateurabwabw-106abw106abw-106
    • 2021-07-09
    176 min

    [IPX-681]Gachimaji Major Top Secret AV Debut of a Real Idol. Mano Yoda.

  • mano yoda censoredbeautiful girlsingle workIPXidea pocketusa pyondishIPX-681IPX681ipx00681
    • 2021-07-24
    240 min

    [HUSR-240]The Country With The Most Beautiful Women In The World! Special Collection Of The Ultimate Weapons From Russia, The Kingdom Of Beauties! Who Ever Knew Russia Had Such Amazing Women？!

  • isabel clark ibana censoredcreampiebig titsHUSRbig mocalbooker thustleHUSR-240HUSR24057husr00240
    • 2021-08-12
    124 min

    [FSDSS-279]High School Teacher, Forbidden French Kiss Fucking With High S*********ls After Class, Meisa Kawakita

  • kawakita meisa censoreduniformschoolgirlFSDSSfalenotakasato yofaleno starFSDSS-279FSDSS2791fsdss00279
    • 2021-08-14
    122 min

    [CHCH-009]A Hunter Who Likes Chubby Girls Leaks Videos Of A Married Woman Who Has Colossal Tits And Who Excited Him The Most In The Past. Akana (38-Years-Old/H-Cup)

  • censoredbig titsamateurCHCHchichi to haha emmanielchichi to hahaCHCH-009CHCH009chch00009
    • 2021-08-15
    60 min

    10musume 081521_01 Just Looking At Sex Toys Makes Her Pussy Wet Hitom Mukai

  • amateur uncensored10musume
    • 2021-08-21
    244 min

    [XRLE-015]Climax Fuck With Innumerable Cocks! Drity Secret Orgy 4 Hour Highlights

  • mizuno chaoyang nozomi hazuki censoredanalcreampieXRLEk m producereal real worksXRLE-015XRLE015xrle00015
    • 2021-08-23
    66 min

    498DDH-029 100 Repeat Rate! Excessive Service Of Sexy Veteran Beauticians! Oil Slimy Nipple Torture X Crawl On All Fours → 60 Minutes Full Course That Keeps Ejaculating With Continuous Vaginal Detox!

  • amateur censoredcreampiebig titsddhddh-029ddh029498ddh-029
    • 2021-09-07
    67 min

    FC2PPV 2172477 * Limited Time Price Until 9/13 [2480pt⇒1980pt] Loli Face Big Milk ★ H Cup Female College Student (19) ★ Love Love Squirting Sex With Older Boyfriend [4k Benefits Available]

  • amateur uncensoredfc2
    • 2021-09-09
    43 min

    [IENFH-008]I Was Playing Pranks On My Big Stepsister That Night, But Then She Turned The Tables On Me And Fucked Me Raw, And I Was About To Cum, But Then She Locked Me Down With Her Legs And I Couldn"t Escape, So I Ended Up Creampie Cumming Insid

  • sakura tsuji censoredcreampieIENFHi energychrysanthemumienfIENFH-008IENFH0081ienfh00008
    • 2021-09-17
    69 min

    230OREC-878 Non

  • amateur censoredcreampieamateurorecorec-878orec878230orec-878
    • 2021-10-06
    80 min

    259LUXU-1480 Luxury TV 1466 A Legal Secretary With A Bewitching Atmosphere Who Suffers From Sexlessness With Her Husband Has Appeared! As Soon As She Is Hugged, She Has A Fascinating Expression On Her Face, And She Leaves Herself To The Desire To Be

  • amateur censoredmarried womanamateurluxuluxu-1480luxu1480259luxu-1480
    • 2021-10-07
    49 min

    C0930 ki211007 Maki Higuchi 32years old

  • amateur uncensoredc0930
    • 2021-10-07
    51 min

    527SROC-016 Mari 2 (Mari Takasugi)

  • amateur censoredamateursrocsroc-016sroc016527sroc-016
    • 2021-10-09
    134 min

    [MKMP-419]Inviting My Mistress Over For Non-stop French Kissing Cowgirl Fucking That Practically Melts My Lips And Dick. Honoka Tsujii

  • tsujii honoka censoredblowjobslutMKMPk m producekindaichishougo roumillionMKMP-419MKMP419mkmp00419
    • 2021-10-15
    124 min

    [VOD-004]A Real Amateur Housewives Document No.2 During Those Few Hours Before Her Husband Comes Home ... Her H-Cup Big Tits Are Lustily, Alluringly, Sweatily, Bouncing For Joy, During Creampie Sex Rie Matsuo

  • rie matsuo censoredcreampiebig titsVODvenustamatsuka bingoreality venusVOD-004VOD004vod00004
    • 2021-10-27
    109 min

    [RDVHJ-139]Amateur!! Mothers And Daughters Picked Up and Creampied Vol. 21

  • censoredcreampiebig titsRDVHJgurafiteijapanfeaesutoRDVHJ-139RDVHJ13948rdvhj00139
    • 2021-11-23
    56 min

    FC2PPV 2455853 [Thank You For Selling 670 Bottles] Debt 200. A Married Woman Who Lives In K City And Reopens The Repayment. She Blames Her Thoroughly And Blames Her About 100 Times. At The End She Made It Into A Horny Wife Who Is Also Good At Anal.

  • amateur uncensoredfc2
    • 2021-12-04
    120 min

    [GVH-328]A Lewd Housewife Who Comes At Me WIth No Bra Or Pants Has Moved In Next Door! Riona Hirose

  • rio hirose censoredslutsingle workGVHglory questkisakura kabinGVH-328GVH328gvh00328
    • 2021-12-11
    147 min

    [MKMP-430]"I"m The Only One Who Can Make You Feel Gooood, So I"m Going To Give You Some Nice Nookie With My Tongue!" A Specialized, Lick-A-Holic Who Will Give You Explosive Nookie And Suck All Of Your Semen And Bodily Fluids With Her

  • hinako mori censoredcreampiebeautiful girlMKMPk m producesamoarimillionMKMP-430MKMP430mkmp00430
    • 2021-12-24
    119 min

    [HMN-089]Fresh Face - In times Like These Can An AV Actress Make Into The Business Wearing A Mask？ Young Voice Actress That Is Currently Out Of Work Gets Lewd For The First Time In About A Year With A Creampie Debut. Shizuku Otohane

  • otowa shisora censoredcreampiesingle workHMNhon nakatiger kosakaiHMN-089HMN089hmn00089
    • 2021-12-24
    68 min

    OREX-330 Fuwari-chan 2 (Hino Fuwari)

  • amateur censoredcreampiebig titsorexorex-330orex330orex-330
    • 2021-12-27
    12 min

    [122721-001]Anal Encyclopedia: Mika Sumire

  • mika sumire uncensoredanalcaribbeancom
    • 2022-01-01
    146 min

    [FLAV-287]Amateur In A Mask Masked S********l With A Full, Plump, And Lecherous Body Becomes A Masochistic Sex Toy

  • censoredamateurFLAVdigital arkkashimadigital ark digital arkFLAV-287FLAV287flav00287
    • 2022-01-06
    247 min

    [TOEN-060]"Checking A Married Couple"s Love" Cheating Spouse"s Memorial Nude Photo Session. 2 Married Couples, 4-hour Special.

  • censoredcreampiemarried womanTOENcenter villagetaoyuanTOEN-060TOEN060h-086toen00060



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi