maid




FC2STARSSANEBODGVHAUKGPPPDHNDWAAAMILKMEYDMVSDCESDMIAANGODSPRDNACXADNFSDSSROYDIPX

2020-11-16
61 min

328HMDN-312 [Married woman eating 3P orgy] Viewer participation planning! Batting a wife and a user who are addicted to big cock! All-you-can-eat until morning, raw squirrel, cum shot up to 3P personal shooting squirrel tide does not stop and rolls u

  • amateur censoredcreampiemarried womanhmdnhmdn-312hmdn312328hmdn-312
    • 2020-11-19
    118 min

    [MVSD-446]Petite Cheeky Bitch Fiddling And Licking Nipples - What's This？ Look How Hard Your Nasty Little Nipples Have Become - Urara Kanon

  • hanaoto urara censoredcreampiebeautiful girlMVSDm s video groupdragon nishikawaMVSD-446MVSD446mvsd00446
    • 2020-11-20
    54 min

    FC2PPV 1561487 [Limited quantity 2980pt → 1980pt] Summer memories: Shinobi hot spring date ❤️ Love love hot spring date in plain clothes ❤️ Yuka who changed into a yukata and all-you-can-suck pink nipples in a private hot spring ❤️ Purchase privilege

  • amateur uncensoredfc2
    • 2020-12-05
    120 min

    [JUL-403]My Friend's Strict And Serious Mother Momoko Keeps Milking My Dick Like I've Never Experienced Before Until My Balls Are All Dried Up... Momoko Isshiki

  • momoko isshiki censoredbig titsmature womanJULmadonnabieber gonzoJUL-403JUL403jul00403
    • 2020-12-15
    180 min

    [DIPO-087]Top Secret Footage Leaked! Married Woman Caught On Hidden Camera With An Older Man - Who Isn't Her Husband! 10 - She Falls For His Seduction!

  • censoredmature womanDIPOprimoero nandesuDIPO-087DIPO087h-283dipo00087
    • 2020-12-17
    131 min

    [DVDMS-613]The Boss's Wife Started Grinding On My Dick So I Gave Her A Quickie! The Sudden Pleasure Of Getting Nailed By Her Husband's Employee Made Her Moan And She Came From Hard Pounding! While Her Husband Was In The Next Room Taking A Bat

  • censoredamateurDVDMSdeep sswing nagaseDVDMS-613DVDMS613dvdms00613
    • 2021-01-25
    96 min

    [SPRBD-044]Capuccino Of Love/Ai Kawana

  • censoredbig titsbeautiful girlSPRBDintec incSPRBD-044SPRBD044h-706sprbd00044
    • 2021-02-07
    65 min

    413INST-094 Ushichichi Holstein daughter ☆ Mami 19 years old Mami ♪ Fertilization mating ♪ Talent office belonging big breasts idol daughter raw Paco Pyupyu ♪ Chinpo milk pouring fertilization copulation ♪ Porcio awakening with ass press ☆ Breast swa

  • amateur censoredcreampiebig titsinstinst-094inst094413inst-094
    • 2021-02-11
    301 min

    [MIST-327]Bubble Massage With Cowgirl Sex As A Bonus - 300 Minutes

  • hasumi claire hosaka eri censoredcreampiebig titsMISTmr michiruMIST-327MIST3271mist00327
    • 2021-02-12
    154 min

    [JUFE-255]Her Good Looks Are Out Of This World! Gorgeous Quarter-Japanese Former C***d Star Is Now A G-Cup! Saeko Hiiragi's Porn Debut!

  • hiiragi saeko censoredbig titsbeautiful girlJUFEfitchmichiru arashiyamaJUFE-255JUFE255jufe00255
    • 2021-02-13
    245 min

    [KDMI-032]Fucking Queen Amazing

  • maria nagai yuki god censoredcreampieKDMImiludopamixKDMI-032KDMI032kdmi00032
    • 2021-02-19
    115 min

    [EVIS-336]Old Fashioned Lesbian Public Bath Run By 4 Beautiful Sisters

  • is it igarashi censoredlesbianEVISebisusan mousouzokubyakkoEVIS-336EVIS336evis00336
    • 2021-03-02
    50 min

    FC2PPV 1709037 * None * Limited to 30 bottles per month! !! !! Outflow! !! Gonzo of ant Shuka-chan with uniform costume ♡ Very satisfied with vaginal cum shot ♡

  • amateur uncensoredfc2
    • 2021-03-05
    240 min

    [FIV-077]The Essence Of Eroticism 3 ~ Big Titty Special! We Love One Night Stands! Revealing The Sexy Truth About Modern Girls!

  • censoredbig titsamateurFIVprestigefive starsFIV-077FIV077118fiv00077
    • 2021-03-06
    30 min

    210AKO-420 NAO

  • amateur censoredamateurakoako-420ako420210ako-420
    • 2021-03-11
    101 min

    [SPRD-1387]I Like My Decrepit Old Ex-Wife Better Than My New Wife ... Akemi Seijima

  • akemi narishima censoredmature womansingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1387SPRD138718sprd01387
    • 2021-03-23
    125 min

    [KIRE-031]"I Wanna Know More About My Erogenous Zones..." Innocent Mature Woman Smothered In Toro Toro Sex Fluids Moans For More. Bred 3 Times During An Oil Massage! Miki Mori, Age 40

  • miki mori censoredmature womansingle workKIREsod createkei morikawabeauty kirei sodKIRE-031KIRE0311kire00031
    • 2021-03-25
    230 min

    [SUN-009]Cum Guzzling Perverted Nutritionist Sucks Dick With Her Long Tongue

  • moe kominato censoredbig titssingle workSUNsunSUN-009SUN00913sun00009
    • 2021-03-27
    149 min

    [DLPN-006]Training My Amateur Wife Like A Dog Naomi-san (30) Natural Masochist / Shameful Pissing / Slender / Shaved Pussy

  • censoredmarried womanamateurDLPNdolphin emmanuelDLPN-006DLPN006dlpn00006
    • 2021-04-03
    240 min

    [MMB-359]A Sudden Visit To Drop By Your Dick - 9 Pussy Deliveries -

  • censoredcreampiebeautiful girlMMBmomotaro video publishingdr ishikiri bridgemomotaro bestMMB-359MMB359mmb00359
    • 2021-04-03
    125 min

    [CMC-252]Female Teacher Ass Play Woman Gets Face Fucked At The Enema Academy Yuri Hirako

  • yuri hirako censoredsingle workCMCcinemagicshinichi kawamuracollectCMC-252CMC252cmc00252
    • 2021-04-09
    148 min

    [EBOD-815]120 Service: Whether It's Sex Or Her Work, This Curvy I-Cup Gives It Her Best - Busty Clerk At A Burger Shop Riku Serina

  • serina riku censoredbig titssquirtingEBODe bodymichiru arashiyamaEBOD-815EBOD815ebod00815
    • 2021-04-24
    99 min

    [BHUST-003]Tokyo Bay Area Only! Nympho Celebrity Sex Circle Lovey Dovey Raw Sex Version!

  • censoredcreampiebig titsBHUSTbig mocalbooker tBHUST-003BHUST00357bhust00003
    • 2021-04-24
    51 min

    [OSST-011]My Korean Girlfriend Is Pure, Innocent, And Totally Natural! This Beauty's Never Been Under A Knife, And She Seems Really Easy To Get Into The Bedroom？!

  • censoredamateurOSSTpatzkin amateurbooker tulchan amateurOSST-011OSST011h-1450osst00011
    • 2021-05-20
    123 min

    [GS-388]I Thought This Female Employee Was An Alluring But Naive Little Country Girl When I First Started Dating Her, But ... She Turned Out To Be An Unbelievably Horny Bitch!! No Matter The Time Or Place, She Would Suck My Dick Deep Into Her Throat

  • censoredbig titscosplayGSsosoru x garcontumblerGS-388GS388h-101gs00388
    • 2021-05-26

    10musume 052621_01 Secret Pussy Collection: Kaori Yamamoto

  • amateur uncensored10musume
    • 2021-06-06
    60 min

    318LADY-377 Haruna

  • amateur censoredamateurbeautiful girlladylady-377lady377318lady-377
    • 2021-06-08
    61 min

    FC2PPV 1858803 * Limited to 2 days 2980⇒1980pt ★ First shot ☆ Explosion Iki! Libido monster ♥ Kaoruko of big breasts plump BODY who writhes 25 years old ☆ Squirting Iki to actor tech ♥ Gun thrust at the first raw insertion and reason collapse! Creamp

  • amateur uncensoredfc2
    • 2021-06-11
    117 min

    [IPX-668]The New Female Teacher Besieged - Overpowered And Bound For A G*******g By Her Own S*****ts! Miu Shiromine

  • shiramine miu censoreddeepthroatsingle workIPXidea pocketbungo maedadishIPX-668IPX668ipx00668
    • 2021-06-26
    55 min

    H4610 ki210627 Chinatsu Kitada 29years old

  • amateur uncensoredh4610
    • 2021-07-02
    149 min

    [HODV-21588]SEX: A Three-Month Illness with Beautiful Women Having the Most Beautiful Legs and Big Beautiful Tits. Amu Hanamiya.

  • hanamiya amu censoredcreampiebig titsHODVh m pHODV-21588HODV215885642hodv21588
    • 2021-07-18
    140 min

    [DBER-118]The Lusty Beast Hunting Club The Cruel Tantalizing Of A Limber-Limbed Sacrifice - A Bewitchingly Beautiful Girl Cums In Hell - Part 8: The Tears And Roars Of The Robustly Sweet Nectar Of A Flesh Fantasy Doll Nanami Ozora

  • nanami ozora censoredbdsmsingle workDBERbabyentertainmentkikubonred babeDBER-118DBER118dber00118
    • 2021-07-21
    154 min

    [DGCEMD-036]*Limited Edition Includes Bonus Footage* Nonstop Orgasms Bring Tears To Her Eyes 11, Starring Yui Hatano

  • yui hatano censoredcreampiemature womanDGCEMDcelebrity friendsDGCEMD-036DGCEMD036dgcemd00036
    • 2021-07-29
    20 min

    HEYZO 2576 Ryou’S Amazing Footjob – Ryou Makoto

  • ryou makoto uncensoredheyzo
    • 2021-07-30
    160 min

    [DVDMS-697]A Normal Boys And Girls Focus Group Adult Video This Business Man And Woman Had Sex On The Magic Mirror Number Bus, And We Followed Up On Them To See What Happened In This Special A Married Woman Office Lady And Her Male Colleague Are Out

  • censoredcreampieamateurDVDMSdeepspoolsideDVDMS-697DVDMS697dvdms00697
    • 2021-08-06
    185 min

    FC2PPV 1960983 [No Amateur Individual Shooting] 100th Work Arrival Commemorative Exposure Work! Large Release Of All The Cultivated Exposure! Perverted Superb Body Naked Wife’S Outdoor Continuous Naked Exposure! The Tag Comes Off And It Becomes

  • amateur uncensoredfc2
    • 2021-08-13
    240 min

    [OOMN-275]A Slender, Beautiful Girl Agonizes By Instinct and Reaches Her Climax. Mitsuha Higuchi.

  • mitsuha higuchi censoredbeautiful girlOOMNabc delusion groupmom.com abc delusion groupOOMN-275OOMN275oomn00275
    • 2021-08-17
    63 min

    FC2PPV 2039283 * Limited To 3 Days 2980⇒1980 ★ First Shot ☆ G Cup Beauty Big Tits Sports Ero Body ♥ Apparel Clerk Makoto-Chan 24 Years Old ☆ Anal Beads Blame Rich Blowjob With Nasty Mouth ♥ Beautiful Big Tits Shaking Meat Bullet Battle ♥ Raw Vaginal

  • amateur uncensoredfc2
    • 2021-08-20
    150 min

    [CJOD-308]Snake Tongue Pussy Reverse Pick Up Harlem If You Just Want To Fuck A Cute Girl, We Will Lick You All Over And Make You Cum Over And Over Until You Can"t Anymore Yumi Saeki Ka Honoka Tsuji

  • yuka saeki tsujii honoka censoredblowjobCJODbimasaki naochijo hebunCJOD-308CJOD308cjod00308
    • 2021-09-11
    125 min

    [DVAJ-532](Cruel Edging) Cocks Left Hanging Right When They"re About To Blow - One "Ruined Orgasm" After Another Without Relief Until Your Dick Explodes With Cum (14 Loads In All) Nanami Kawakami

  • kawakami nanami censoredcreampieslutDVAJalice japansamoariDVAJ-532DVAJ532dvaj00532
    • 2021-09-24
    152 min

    [DASD-918]Demanding Licking And Sucking From Both Sides. Deep Throat. Yumi Saeki ka, Hina Nanami

  • yuka saeki hina nanami hina nanase censoredblowjobslutDASDdasmasaki naoDASD-918DASD918dasd00918
    • 2021-09-24
    54 min

    FC2PPV 2244742 [Leakage] * Limited Number Of Sales * S-Class Magazine Model Talent September Gonzo With A Cameraman During Life Gonzo Sex Outflow Rider Like A Beast [Handling Precautions]

  • amateur uncensoredfc2
    • 2021-09-29
    153 min

    [IBW-841]My Tanned Stepdaughter Hits The Sweet Spot Lala Height: 142cm

  • amateur censoredbeautiful girlIBWi b worksIBW-841IBW841
    • 2021-10-01
    238 min

    [CLUB-655]We Went Picking Up Girls And Took Home This Friendly Pair Of Girls We Met At An Izakaya. If We Quietly Have Sex, Will Their Tight-Legged Friends In The Next Room Get Horny And Let Us Fuck Them Too？ 28

  • censoredbig titsCLUBhentai gentleman clubCLUB-655CLUB655club00655
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-02
    74 min

    534IND-007 Blow Job Declaration Of Mouth Skills Masashi Beauty Enmitsu Cum Inside Video Leaked! !!

  • amateur censoredcreampiebig titsindind-007ind007534ind-007
    • 2021-11-05
    80 min

    483SGK-051 [Large Climax That Trembled In The United States] [Creampie In Rage & Super Facial Cumshot] [The Biggest Impact Of The Year] [* Be Careful Too Much *] The Climax Next To The Trembling Climax In The United States! !! !! The Climax Child

  • amateur censoredcreampiesquirtingsgksgk-051sgk051483sgk-051
    • 2021-11-08
    31 min

    [551MA002-1]個撮睡眠姦記録 vol.7

  • amateur censoredcreampieamateurma002ma002-1ma0021551ma002-1
    • 2021-11-11
    125 min

    [ARMF-020]A Lusty Married Woman Full-Body Pictorial No.1

  • kobayakawa reiko tsukishima sakura censoredanalmature womanARMFaroma kikakunyotai fetishismARMF-020ARMF020armf00020
    • 2021-11-25
    126 min

    [FANH-034]Teeny Tiny Flexible Teen With Big Tits - Tennis Player Hibiki - Beautiful Girl From The Country"s Secret, Dangerous After School Sex Ed - 2 Loads!

  • censoredcreampiebig titsFANHhamedori.network secondeditionFANH-034FANH034h-1472fanh00034
    • 2021-11-25
    240 min

    [SDJS-129]SODに今年入社した新入社員7人が同僚の前でアソコを晒して凝視されちゃう男女混合全裸健康診断2021

  • hongou maya takayama suzu censoredSDJSchain shuuchain shuusod createSDJS-129SDJS129
    • 2021-12-11
    115 min

    [NSFS-049]New Atonement 6: The Wife Who Gave Her Body and Soul to Be Forgiven Mami Nagase

  • asami nagase censoredsingle workdramaNSFSnagae stylejotaro tomiNSFS-049NSFS049nsfs00049
    • 2021-12-18
    111 min

    [BBTU-027]Massaging Colossal K-Cup Tits To Complete Destruction, Screaming, And Insane Orgasm Koume Ena

  • ena koume censoredbig titssquirtingBBTUdogmatenunmy big titsBBTU-027BBTU027bbtu00027
    • 2021-12-23
    135 min

    [HBAD-605]Stylish and Beautiful Housewife - this Young Housewife Loves Hot Sex and Gives Pleasure to All the Men in Her family Including Her Father in Law. Riona Hirose.

  • rio hirose censoredsingle workHBADhibinonamitaro umababeHBAD-605HBAD6051hbad00605
    • 2021-12-24
    65 min

    OREX-325 Miku-san 2 (Miku Kurusu)

  • amateur censoredcreampiebig titsorexorex-325orex325orex-325
    • 2021-12-31
    260 min

    [DVDMS-759]Regular Men And Women Monitoring AV. Fakecest And Then The Full Story Of What Happens After For This Special. Magic Mirror For These Devoted Step-parents To Face! Big Tits Older Step-sis And S********l Younger Step-sister Get Into A Sandwi

  • censoredcreampieamateurDVDMSdeep sDVDMS-759DVDMS759dvdms00759



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi