pervert




FC2RBDAUKGHNDCAWDSTARSMVSDMIAACESDSSISFSDSSVENUDTTDASDKBIWAAAAWDGVHHDKAAPODATID

2020-10-31
55 min

FC2PPV 1553484 [Personal shooting] First shot ★ Seiko The 24-year-old hairdresser is a beautiful woman with long hair! A carnivorous girl who likes intense SEX is violently fucked and vaginal cum shot!

  • amateur uncensoredfc2
    • 2020-11-04
    240 min

    [RVH-005]Anal Bitch BEST vol. 1

  • nozomi hazuki iku kuroki censoredslutRVHglory questRVH-005RVH00513rvh00005
    • 2020-12-04
    242 min

    [DOCP-263]My Girlfriend's "Little Sister" Is A Little Devil Who Lured Me To Temptation...!？ My Girlfriend Is Right Nearby, But She Keep Hitting Me With Nonstop Whispering Dirty Talk 2

  • fluffy love uryuki sara censoreduniformsisterDOCPprestigedoc premiumDOCP-263DOCP263118docp00263
    • 2020-12-18
    232 min

    [SIM-102]I Was Infatuated With My Female Co-Worker, And I Finally Succeeded In Bringing Her Home With Me! I Secretly Installed Cameras To Film What Happened Next, And With Some Good Vibes And Luck, I Might Get To Shoot Some POV Sex!？

  • censoredcreampieSIMprestigeshirotomanmanSIM-102SIM102118sim00102
    • 2020-12-27
    48 min

    H4610 ori1744 Sayaka Arahashi 20years old

  • amateur uncensoredh4610
    • 2021-01-02
    189 min

    [UMD-764](Daily Erotica) I Just Happened To Cum Upon A Dream-Cum-True Erotic Situation, And Usually I Would Never Get To Fuck A Girl Like This, But Here We Present To You A Lucky Fuck (6 Stories)

  • jinguji temple nao ayumi shinoda censoredbig titsUMDleotabu osakiUMD-764UMD764125umd00764
    • 2021-01-03
    83 min

    300NTK-495 Erotopia tall 172cm beauty GAL! !! Hard SEX lovers who are good at reverse Nan with Echiechi underwear! ？？ SEX party starts with erotic girls who are lifted up with norinori tension! !! Directly thrust the finest beauty with shining underw

  • cmgal censoredcreampieamateurntkntk-495ntk495300ntk-495
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-16
    65 min

    FC2PPV 1647677 * Limited time 2980⇒1400pt! ★ Intense hot cum shot 3P orgy with devilish pleasure ♥ Miya-chan & Yukino-chan ② ☆ On the verge of exploding to a perverted blame ♥ Thick double blowjob with patience juice ♥ Reasonable raw vaginal cum

  • amateur uncensoredfc2
    • 2021-01-30
    56 min

    C0930 ki210131 Mai Katagiri 26years old

  • amateur uncensoredc0930
    • 2021-02-11
    124 min

    [NSM-028]An Aphrodisiac Oil Massage Peeping & Creampie Fucking With Amateur Girls VOL.28 We Used This Compound Of Super Powerful Aphrodisiacs Mixed Into Massage Oil And Used It On These Unsuspecting Ladies, And They Were Surprised To Find Their Bo

  • gloss hall shiori endo bookmark satoshi yamaguchi censoredcreampieNSMnishi shinjuku massage main officeaphrodisiac massageNSM-028NSM028h-1342nsm00028
    • 2021-02-11
    39 min

    [ore-754]ミイナ

  • amateur censoredcreampiebig titsoreore-754ore754ore-754
    • 2021-02-11
    110 min

    [FSDSS-166]My New Wife - Sora Fucks Like A Slut, Sora Amakawa

  • tenkawa sora censoredbig titssingle workFSDSSfalenoyamaguchi memberfaleno starFSDSS-166FSDSS1661fsdss00166
    • 2021-02-23

    FC2PPV 1698568 Amateur Gonzo 37

  • amateur uncensoredfc2
    • 2021-02-28
    130 min

    [JUTA-115]Ultimate! An AV Document Of The First Undressing Of A 30-something Wife - Reina Hirokawa

  • reina hirokawa censoredcreampieblowjobJUTAjukujo japanhachibee ikariJUTA-115JUTA115juta00115
    • 2021-03-05
    80 min

    259LUXU-1393 A beautiful woman who works on the production of Luxury TV 1374 AI and who is just right for the word “talented” decides to appear on AV with the intention of releasing the desire to lose her place. She oozes her love juice in

  • amateur censoredamateurluxuluxu-1393luxu1393259luxu-1393
    • 2021-03-05
    47 min

    FC2PPV 1712901 [First shot] That girl with a positive appearance was the owner of a chewy nice ass ♥♥

  • amateur uncensoredfc2
    • 2021-03-07
    101 min

    300MIUM-685 【Super! Hello! Project Face] Looks Idol-class nursing student rented as her! Completely REC the whole story that was spoiled up to the originally prohibited erotic acts by persuading! !! After enjoying a Harajuku date, Erokos SEX at the h

  • amateur censoredcreampiebig titsmiummium-685mium685300mium-685
    • 2021-03-12
    197 min

    [DSS-222]Picking Up Amateur Girls! No. 222 Loads Of Beautiful Hybrid Girls! Tokyo Alerts Version

  • censoredamateurbeautiful girlDSSmomotaro video publishingdukelady huntersDSS-222DSS222dss00222
    • 2021-03-18
    57 min

    413INST-105 Hikaru Chan (19) When an angel in a white coat sees a cock, it suddenly changes ♪ "You should look at this and squeeze!"☆ A nurse who tries to squeeze semen by holding a raw cock from herself

  • amateur censoredbig titsamateurinstinst-105inst105413inst-105
    • 2021-03-25
    94 min

    [OKP-080]These Boobs Will Make You Lose Your Mind! Godly Big Tits, Marshmallow Soft - Nanami Matsumoto - Soft, Barely Legal Body In A Micro-Bikini, Incredible Close-Ups Of Her Big Tits, Cowgirl Sex, And Titty Fuck - Enjoy Her Craw With Creampie Sex,

  • nana matsumoto censoredbig titssingle workOKPdaddy s private photosgoro koenjigodly pantyhoseOKP-080OKP0801okp00080
    • 2021-04-05
    106 min

    [SCR-269]Lecherous Step Father Has Only One Goal - To Fuck His New Wife's Daughter! Upload Video

  • censoredcreampiebeautiful girlSCRglay zs crimeSCR-269SCR26912scr00269
    • 2021-04-17
    229 min

    [CJOD-293]"Please Introduce Me To Your MILF Friend" One Married Woman Creampie After Another! Cheating Wives Tired Of Their Husband's Cock

  • censoredcreampieslutCJODchijo heavenkanoa tojoCJOD-293CJOD293cjod00293
    • 2021-04-24
    47 min

    492JCHA-022 I Want A Woman To talk to me 1

  • amateur censoredschoolgirlamateurjchajcha-022jcha022492jcha-022
    • 2021-04-24
    66 min

    FC2PPV 1784366 [First shot from a rural area] An active underground idol. Her first mass vaginal cum shot to a beautiful girl who likes 18-year-old K-POP. Each other’s first entanglement with Virgin-kun. I couldn’t stand the tight pussy and

  • amateur uncensoredfc2
    • 2021-05-20
    225 min

    [HAWA-248]She's Having Sex Behind Her Husband's Back "The Truth Is, I've Never Even Drank My Husband's Cum" She's Over 30 And D***king Cum For The First Time She's Always Hiding Her Perverted Desires From Her Husban

  • censoredsquirtingdeepthroatHAWAcosmos eizohawai nagasecosmospictures soft on demandHAWA-248HAWA2481hawa00248
    • 2021-05-25
    120 min

    [SAN-003]Fucked By My Husband's Gross Boss The Shame Of A Completely Dominated Wife Saeko Hiiragi

  • haruki sato censoredcreampiesquirtingSANprestigesanSAN-003SAN003118san00003
    • 2021-05-29
    150 min

    [LULU-073]Married Woman Realtor With A Perky Booty Can't Hide How Horny She Is For Her Hung Client During A Private Viewing. They Start With A Creampie Quickie And Keep Fucking Until She's Totally Satisfied. Ameri Hoshi

  • star ameri censoredcreampiesingle workLULUlunaticsluminaxLULU-073LULU073lulu00073
    • 2021-06-15
    49 min

    481SACZ-039 Sachiyo 5

  • amateur censoredamateurmature womansaczsacz-039sacz039481sacz-039
    • 2021-07-09
    177 min

    [IPX-682]Hot Kisses and Sweaty Sex with a Pure Beatiful Girl. Kotoyumi Ono.

  • kotoyumi ono censoredblowjobbeautiful girlIPXidea pocketusa pyondishIPX-682IPX682ipx00682
    • 2021-07-09
    82 min

    259LUXU-1441 Luxury TV 1428 [Split Tan] is now available as a gentle president’s secretary! Deep kiss, nipple licking, blowjob with a fascinating tongue divided into two! Water the men of the world with a rich and sticky tongue!

  • amateur censoredamateurluxuluxu-1441luxu1441259luxu-1441
    • 2021-08-13
    150 min

    [SSIS-102]Amateur NO.1 STYLE Kaede Fua AV Debut

  • kaede fua censoredbeautiful girlsingle workSSISs1 no 1 stylemonSSIS-102SSIS102ssis00102
    • 2021-08-14
    128 min

    [SORA-328]My Young Step Niece Came And Visited For A Vacation In The Country, So I Decided To Take Her By The Hand And Put Her Through Exhibitionist Training. She Became Hooked On Shameful Pleasure, And Began To Beg Me, "Please Watch Me In My Sha

  • marina saito censoreduniformschoolgirlSORAyama to sorausubashi suiSORA-328SORA328sora00328
    • 2021-08-24
    121 min

    [FTDSS-003]Legendary Scout Who Sent 10,000 Women To The AV Industry Nietzsche of Kabukicho Dirty Instincts, Super Sex 3 videos + 1 Cum Yoko Tsukasa.

  • yoko tsukasa censoredFTDSSfalenonietzsche in kabukichofalenotubeFTDSS-003FTDSS0031ftdss00003
    • 2021-09-03
    128 min

    [HODV-21606]Ultimate Masochist Wants To Be Trained So Pain Makes Her Cum. Kana Tanaka

  • kana nakata censoredcreampiedeepthroatHODVh m pHODV-21606HODV216065642hodv21606
    • 2021-09-17
    168 min

    [JUFE-330]Gorgeous Married Woman Gives Sweet Wet Kisses In Classy Lingerie During Hot Sex. Guy From The Country Finds Temptation In The City From His Uncle"s Wife. Akari Niimura

  • akari shinmura censoredcreampiebig titsJUFEfitchJUFE-330JUFE330jufe00330
    • 2021-09-24
    150 min

    [SSIS-185]My Bride"s Bizarre Infidelity Is Terrible, Just Too Terrible - Ichika Hoshimiya

  • ichika hoshimiya censoredsingle workSSISs1 no 1 stylekannana dainanaSSIS-185SSIS185ssis00185
    • 2021-10-02
    59 min

    HEYZO 2622 Sleep With My Boyfriend! -NTR Request From My Best Friend- – Shiori Yamagishi

  • amateur uncensoredcreampiehandjobheyzo
    • 2021-10-07
    181 min

    [SHIND-018]A Relentless Stalker Goes Hunting For Maso Bitches On The Train A Home Invasion Record #34 35

  • censoredamateurSHINDshinkirousuzuki o maSHIND-018SHIND018h-1560shind00018
    • 2021-10-08
    100 min

    300MIUM-752 Miss God Body Lounge! !! [Perfect G Milk x Pink Nipples] x [Excellent Fucking x Soggy Blowjob & Ball Licking Service] x [Explosive Tide Overflowing From Shaved Bread x Sweaty Explosive Sex] The Appearance Of Crazy Crazy Body Is Too Ero

  • amateur censoredbig titssquirtingmiummium-752mium752300mium-752
    • 2021-10-12
    132 min

    [KTRA-334]Lovey-Dovey Sex Between a Step-Uncle and His Step-Niece. Aya Mamiya

  • aya mamiya censoredcreampieblowjobKTRAk tribeKTRA-334KTRA334
    • 2021-10-16
    180 min

    [AUKS-130]Lesbian Ban Lifted! Tan Bikini Lesbian REMI Aisha Yuzuki

  • remi yuzuki aisha censoredlesbianAUKSu ktakiguchi shiruviaAUKS-130AUKS130auks00130
    • 2021-10-21
    202 min

    [SUN-033]Tropical Exhibitionist Deluxe - Golden Shower Girl Yuuri-chan D***ks Cum And Gets Creampied On Vacation

  • rena censoredsingle workSUNsuntanaka baconSUN-033SUN03313sun00033
    • 2021-10-21
    50 min

    413INST-176 [Married Woman / Orgy Individual Shooting] Big Breasts I Cup ★ Spodim Married Woman Who Trains To A Super Body Like A Model. It Falls Alive By Being Stabbed By A Big Cock Near A Mama Friend. Of Course, Plenty Of Seeding! (Rinne)

  • amateur censoredcreampiebig titsinstinst-176inst176413inst-176
    • 2021-10-23
    116 min

    [BDSR-462]When I Called For A Prostitute, The Worst Thing Happened: A Married Former Colleague Showed Up!!

  • chitose in the evening yoshine yuria censoredcreampiebig titsBDSRbigmorkalyumejibig mocalBDSR-462BDSR46257bdsr00462
    • 2021-10-29
    65 min

    FC2PPV 2385426 * Limited Time Price & Bonus * [Celebration !! First Lesbian & First Orgy] Beautiful Sister-In-Law Wife Husband Exchange Swapping Plump Busty Sister And Slender Body Sister Are Inserted W Cock While Lesbian Kissing Sensitivity Ma

  • amateur uncensoredfc2
    • 2021-11-03
    40 min

    FC2PPV 2399054 [Main Story Appearance] I Tried It With A Gal I Picked Up At A Smoking Area!

  • amateur uncensoredfc2
    • 2021-11-03
    74 min

    230OREC-925 Mitsuki (Nagisa Mitsuki)

  • amateur censoredcreampieamateurorecorec-925orec925230orec-925
    • 2021-11-06
    58 min

    478LOLI-036 Shortcut Is Very Cute Wind Band Kirari-Chan And Gachi Creampie Sex (Rin Kira)

  • amateur censoredcreampieschoolgirlloliloli-036loli036478loli-036
    • 2021-11-11
    120 min

    [PXH-039]【フルバージョン】おうぼガール ♯013♯ななみ(20) ♯ゆめかわ♯驚愕の可愛さ♯うさ耳透けコス♯キュン死必須のテレ顔♯先天性ビショ濡れ体質♯プリップリの弾ける雪肌

  • amateur censoredcreampieamateurpxhpxh-039pxh039pxh-039
    • 2021-11-11
    148 min

    [RCTD-432]For Women: A Nipple-Rubbing Clinic and Physical Exam

  • akari shinmura yamamoto renka censoredbig titsschoolgirlRCTDrocketroot yamazakiRCTD-432RCTD4321rctd00432
    • 2021-11-19
    199 min

    [MISM-221]Deep Throat Dating App Yuria Nanamiya

  • yuria nanamiya censoreddeepthroatsingle workMISMemumusume labkuro kokoaMISM-221MISM221mism00221
    • 2021-12-09
    59 min

    Pacopacomama 120921_569 Wives Drink Cum 122: Do You Hate The Fishy Smell!？ Kyoko Moriguchi

  • amateur uncensoredpacopacomama
    • 2021-12-10
    144 min

    [DASD-949]I Was Turned Into A Woman, And My Best Friend Wanted Me To, And I Accepted, And My Heart Became A Woman Too. Yuri Fukada

  • yuri fukada censoredcreampiebig titsDASDdasrokusaburo mishimaDASD-949DASD949dasd00949
    • 2021-12-10
    118 min

    [JUL-792]The Never-ending Days Of Nakadashi-wa... Nao Jinguji

  • jinguji temple nao censoredcreampiebig titsJULmadonnamametaro mamezawaJUL-792JUL792jul00792
    • 2021-12-31
    178 min

    [MIFD-192]Amateur Who"s Popular With Y********ls Keeps Her Account Name Secret! Meet This Hot New Charismatic Influencer With 80,000 Followers! Porn Debut Of A Beautiful Young Influencer With A Beautiful Face, Hot, Slender Body, And Big Tits! Amu

  • amu kodama censoredbig titsbeautiful girlMIFDmoodyzusa pyonmoodyz freshMIFD-192MIFD192mifd00192



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi