pregnant




FC2SSNIVENUMIDVHMNSDABVENXHZGDAWDSQTESSISVEMAATIDAVSASANHDKARBDNACRSHKDAPODSTARS

2021-01-23
135 min

[JUL-442]A Revival Of An Exclusive Madonna Label Actress No.2!! I Went On A Business Trip With My Favorite Lady Boss, And To My Surprise, We Were Booked Into The Same Room At A Business Hotel Asahi Mizuno

  • mizuno chaoyang censoredbig titsmature womanJULmadonnamametaro mamezawaJUL-442JUL442jul00442
    • 2021-01-23
    178 min

    [CAWD-169]Cute, Sexy Real Life College S*****t! This Lady loves To Fuck So She Made Her Porn Debut! Rina Yoshino

  • rina yoshino censoredsquirtingsingle workCAWDkawaiiusa pyonCAWD-169CAWD169cawd00169
    • 2021-01-29
    240 min

    [NASH-448]Adultery - Unsatisfied Married Woman`s Adulterous Heart -

  • censoredcreampiemature womanNASHnadeshikoNASH-448NASH448h-067nash00448
    • 2021-02-05
    60 min

    [PARATHD-3115]Sugar Baby (2) - Prim, Pretty Office Girl (Age 25) Does Anal

  • censoredamateurblowjobPARATHDparadise tvPARATHD-3115PARATHD3115parathd03115
    • 2021-02-20
    120 min

    [C-2617]Girl Trip 018

  • censoredlesbianCgogoscore gogo sC-2617C2617
    • 2021-02-21
    123 min

    [HND-955]My Daughter-in-law Became Too Fascinated With Me, She Turned Into A Slut With A Pregnancy Fetish - Eimi Fukada

  • emi fukada censoredcreampieblowjobHNDhon nakamiyoshi rusherHND-955HND955hnd00955
    • 2021-02-25
    43 min

    [orec-698]ひめか

  • amateur censoredcreampieamateurorecorec-698orec698orec-698
    • 2021-02-26
    44 min

    FC2PPV 1702963 [Personal shooting] I reunited with my wife who was conceived by another person! The body of a pregnant woman is full of libido and leads another stick [Creampie]

  • amateur uncensoredfc2
    • 2021-02-26
    80 min

    [OTIM-058](For Streaming Editions) (Daydream POV Fantasies) Every Once In A While, It's Nice To Have A Day Like This ... I Spent The Entire Work Day Not Doing Work, Fucking My Excessively Cute Colleague Hikari Nozomi

  • hope light censoredcreampieuniformOTIMprestigeonetimeOTIM-058OTIM058118otim00058
    • 2021-02-27
    120 min

    [MIRD-210]My Colleagues From My Part-Time Job Missed Their Last Train Home, So Now They're Spending The Night At My Place!! They're Unleashing Their Full Erotic Powers And Wiggling And Jiggling Those 4 Big Divine Titties Until The Break Of Da

  • tsubaki rika nene tanaka censoredbig titsslutMIRDmoodyzwild sevenmoodyz realMIRD-210MIRD210mird00210
    • 2021-03-05
    41 min

    FC2PPV 1713074 [Personal shooting] A slender married woman who accepts other people’s cocks because her husband is unemployed and supports her household budget! [Creampie]

  • amateur uncensoredfc2
    • 2021-03-06
    41 min

    FC2PPV 1714749 Transcendental Sensitive Girl ♥ Amateur-like Reaction Is Unbearable (> _ <) Cum Inside SEX ♥ * High Quality Version & Review Benefits ♪ [Personal Shooting / Original]

  • amateur uncensoredfc2
    • 2021-03-13
    119 min

    [MIAA-408]During The Wedding, While Her Family Was There Beside Her, This Cunt Crack Loving Shotacon Sneaked Underneath Her Skirt And Started Playing With Her Pussy Until The Bride Ended Up Spasming And Pissing Herself While Cumming Nozomi Azuma

  • nozomi higashi censoredsquirtingsingle workMIAAmoodyzdragon nishikawaeveryone s porn starMIAA-408MIAA408miaa00408
    • 2021-03-18
    86 min

    [THNIB-070]The Cutest Girl In Class/Sakura Hyakuno

  • censoredbig titsbeautiful girlTHNIBintec incTHNIB-070THNIB070h-706thnib00070
    • 2021-03-19
    54 min

    328HMDN-346 [W Demon Cock 3Px Married Woman] Married Woman Aina 37 Years Old Wife Who Was Addicted To 3P With Intense Pleasure! From the top to the bottom, if you keep dying the lewd pussy of your cheating wife who is happily numb to the merciless pi

  • amateur censoredcreampiemarried womanhmdnhmdn-346hmdn346328hmdn-346
    • 2021-03-25
    110 min

    KDS-001 [Delivery only] Kyun de Shun VOL.1 Sakura 21 years old Take a blowjob selfie with your own camera! ？？ Tohoku <Bitch> Beauty Tokyo’s first landing! !! "I like to see from the perspective of a Gonzo man" What is your Gonzo expe

  • amateur censoredcreampieamateurkdskds-001kds001kds-001
    • 2021-04-04
    59 min

    HEYZO 2508 Wanna Be Fucked By Amateur Nympho MILF! Vol.4 – Kana Miura

  • kana miura uncensoredcreampiehandjobheyzo
    • 2021-04-08
    244 min

    [NHDTB-512]Full Service Blushing Sluts 13 - Bakers, Car Washers, Strawberry Pickers, Takoyaki Cooks

  • censoredbig titssquirtingNHDTBnatural highitaka smithlin powderNHDTB-512NHDTB5121nhdtb00512
    • 2021-04-24
    40 min

    C0930 hitozuma1353 Sae Nanmoku 26years old

  • amateur uncensoredc0930
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-02
    47 min

    188HINT-0457 Seiko

  • amateur censoredcreampiebig titshinthint-0457hint0457188hint-0457
    • 2021-05-07
    114 min

    277DCV-181 Is it okay to send it home？ case.175 Rainy day former TV station announcer appeared! [Live SEX live commentary] ⇒ "Women’s announcer is a national side dish" F cup! Minami Tanaka of Kyushu ⇒ Convulsions, ascension, fainting &#

  • amateur censoredamateurdcvdcv-181dcv181277dcv-181
    • 2021-05-14
    56 min

    285ENDX-343 Shortcut Slender JD! I inadvertently lusted for another person’s masturbation consultation!

  • amateur censoredamateurendxendx-343endx343285endx-343
    • 2021-05-27
    55 min

    358WITH-101 Mitsuki (20) S-Cute With Gonzo H with her too beautiful

  • amateur censoredcreampieamateurwithwith-101with101358with-101
    • 2021-05-29
    123 min

    [SQTE-370]Mikako Abe New Dismantling Book

  • abe mikako censoredcreampieblowjobSQTEs cuteSQTE-370SQTE370sqte00370
    • 2021-06-17
    121 min

    [BST-023]Travel Agency Sales Manager I Had Business Sex With A Virgin! Nanao Nakano

  • censoredamateurbeautiful girlBSTrubyboston bagBST-023BST023118bst00023
    • 2021-06-19
    134 min

    [DASD-882]Perky Nipples Slick With Saliva - S********l Slut Loves Tongue Play Hana Shirato

  • white peach censoreduniformbeautiful girlDASDdassamoariDASD-882DASD882dasd00882
    • 2021-06-19
    121 min

    [NNPJ-455]Outdoor Kissing S********ls - Car Date Moves To A Love Hotel For 6 Raw Loads

  • censoredcreampieuniformNNPJnanpa japanNNPJ-455NNPJ455nnpj00455
    • 2021-06-22
    140 min

    [SDTH-008]A girl who loves semen and looks super cute and happy when she swallows cum. A total of 11 cumshots taken in the open air, where she swallows the thick cum to the very last drop. Tokyo, Suginami, *** Shopping Street Part-time job in a hambu

  • atsuko nakajima censoredsingle workSDTHsod createafuro takahashieromanSDTH-008SDTH0081sdth00008
    • 2021-07-01
    49 min

    FC2PPV 1877063 [Personal shooting] Kotomi, 18 years old! Lori girl with a height of 145 cm with super big cock deep throat deep throat her anal licking raw squirrel mass facial cumshots! !!

  • amateur uncensoredfc2
    • 2021-07-07
    52 min

    PWIFE-754 Sara

  • amateur censoredcreampiebig titspwifepwife-754pwife754pwife-754
    • 2021-07-09
    120 min

    [EBOD-843]1 Week Without Parents Being Home... Open To Sex Because We Were Born Overseas. Already Half-Naked Step-Sisters and Me 3 of Us Living Together Covered in Big Tits. Karen Aimi and Rika Aimi

  • karen kaede rumi tadami censoredbig titsblowjobEBODe bodykc takedaEBOD-843EBOD843ebod00843
    • 2021-07-10
    125 min

    [MMNT-009]The Amount Is Just... Wow. The Top Squirter in Japan Today Was Raised Carefully by Her Parents as a Sheltered Girl. AV Debut, Risa Aino.

  • ainori censoredsquirtingblowjobMMNTk m producetrendy yamaguchimillion mintMMNT-009MMNT009mmnt00009
    • 2021-07-14
    45 min

    494SIKA-093 Small Breasts J ○ Who Wants A Cock Spree In 4P

  • amateur censoredamateurbukkakesikasika-093sika093494sika-093
    • 2021-07-14
    120 min

    [GVH-265]A Stepmother And Her Stepchild Have Sex. Rieko Hiraoka.

  • rieko hiraoka censoredcreampiemature womanGVHglory questkisakura kabinGVH-265GVH26513gvh00265
    • 2021-07-18
    239 min

    [OKAX-757]A Beautiful Mature Woman With A Private Massage Room Is Sexy And Horny For Her Age! Can You Fuck Her Free Of Charge？ 4 Hours

  • censoredmature womanOKAXk m producedick mandokuokazuOKAX-757OKAX757okax00757
    • 2021-07-18
    26 min

    FC2PPV 1929022 [Limited Number 600pt Off] Beautiful Woman Immediately Shoots 3 People At The Hotel Without Blowjob (Sometimes Irama) ☆ Technician Ol Mika Vol.3

  • amateur uncensoredblowjobfc2
    • 2021-08-06
    120 min

    483SGK-036 [Blonde Tsundere Creampie Gal] [Raw Saddle Creampie Facial Cumshot 2 Barrage] [Super Ikippa Beast Sex] [Super De M With Such Appearance] [Overwhelming Ass Overwhelming F Breasts Cabaret] The Strongest And Best Tsundere Gal Bomb !! Usually,

  • amateur censoredcreampiebig titssgksgk-036sgk036483sgk-036
    • 2021-08-27
    17 min

    FC2PPV 2086170 Uncensored Appearance! [Superb Egg Beauty Man Ahegao] De M Slender Beautiful Girl Manami-Chan (Personal Shooting)

  • amateur uncensoredfc2
    • 2021-08-28
    56 min

    [fc2-ppv 2092512]恥ずかしがり屋の美少女登場！！アイドル顔負けのルックス、小さなお口で初老の巨ちん喉奥挿入、白昼の車内で過去最大射精に唖然 FC2-PPV-2092512

  • amateur uncensoredfc2
    • 2021-09-02
    112 min

    [AKDL-135][In Love With Her Armpits] You"re In Love With My Armpits, Mako Shion

  • miko shio censoredcreampiebeautiful girlAKDLaquinoriaquinoriaknrAKDL-135AKDL1351akdl00135
    • 2021-09-03
    143 min

    [HODV-21603]I Went Back To My Hometown And Rekindled The Crush I Had On My Middle-School Classmate Nine Years Later, The Three Days I Fell In Love Again Hazuki Wakamiya

  • wakamiya censoredcreampiebig titsHODVh m pkc takedaHODV-21603HODV216035642hodv21603
    • 2021-09-07
    61 min

    FC2PPV 2170713 [New Work, Half Price! ] ♀ 161 Female College Student ◯ Yu-Chan 23 Years Old 14th Time Av Actress Dirty Little Do Mjd Cleans From Facial Cumshots With Serious Desire Ma ◯ Ko Blow Non-Contraceptive Hard Sex!

  • amateur uncensoredfc2
    • 2021-09-10
    115 min

    [JUL-706]Lonely In My Fishbowl Life. Iori Nanase

  • iori nanase censoredcreampiebig titsJULmadonnainaballJUL-706JUL706jul00706
    • 2021-09-17
    119 min

    [MEYD-705]NTR At My Part-Time Job I Was Listening To A Horny Married Woman Complain About Her Life, And Then She Started Having Creampie Sex With Me, Every Single Day Ichika Seta

  • kazuhana seta censoredcreampiebig titsMEYDtameike goroinugami ryouMEYD-705MEYD705meyd00705
    • 2021-09-17
    50 min

    FC2PPV 2214534 [One-Day Limited 2200 → 1200pt] [Individual Shooting] Enlighten By Fooling Around The J System That Has Just Transferred From The Countryside [Creampie]

  • amateur uncensoredfc2
    • 2021-09-18
    129 min

    [MGMQ-080]I Want This Beautiful Big Tits Little Devil Girlfriend To Anal Fuck Me, Anytime, Anywhere, All The Time. Hazuki Wakamiya

  • wakamiya censoredanalblowjobMGMQmegamibijo shin queenMGMQ-080MGMQ080mgmq00080
    • 2021-09-24
    143 min

    [CJOD-314]"Hey... Why Are You Twitching So Hard There" Expert Slut Reverse Pick Up. Sudden Male Squirting. Yu Shinoda , Hibiki Otsuki

  • shinoda yu otsuki sound censoredcreampieslutCJODbiham the mcchijo hebunCJOD-314CJOD314cjod00314
    • 2021-10-10
    63 min

    300NTK-645 [Underground Idols #God Body #Tall G Breasts And Individual Shooting In Love Hotel! !! ] G Milk Glamorous God Body Hissage Love Hotel Individual Shooting! !! It Should Be Strictly Prohibited To Touch … Immediate Squirting From The Lif

  • ssrgsex censoredcreampiebig titsntkntk-645ntk645300ntk-645
    • 2021-10-20
    132 min

    [GVH-303]Boss With Sick Body And Sexy Son Aoi Yurika

  • yurika censoredcreampiebig titsGVHglory questhyonGVH-303GVH303gvh00303
    • 2021-10-21
    50 min

    413INST-176 [Married Woman / Orgy Individual Shooting] Big Breasts I Cup ★ Spodim Married Woman Who Trains To A Super Body Like A Model. It Falls Alive By Being Stabbed By A Big Cock Near A Mama Friend. Of Course, Plenty Of Seeding! (Rinne)

  • amateur censoredcreampiebig titsinstinst-176inst176413inst-176
    • 2021-10-30
    151 min

    [KTB-054]Wife Next-door Wears Tight Suits And Is Actually A Horny Semen Junkie That Gets Sexual Harassment And BUKKAKE At The Office Each Day! Office Lady Club 10. Monami Takarada

  • takarada monami censoredcreampiebig titsKTBkahanshin tigers mousozokukahanshin tigersKTB-054KTB054ktb00054
    • 2021-11-06
    240 min

    [NASH-600]Her Meaty Pussy Will Snugly Suck And Slurp At Your Cock Until You Unload Massive Ejaculations Of Cum! Thrust Your Semen Up Into Her Cunt! A 4-Hour Best Hits Collection Of Cowgirl Sex 2

  • censoredcreampiemarried womanNASHpinknadeshikoNASH-600NASH600nash00600
    • 2021-11-20
    130 min

    [MGMQ-084]M-sexual Clinic With Genius S-Lascivious Nurse Who Treats The Anus Of Every Man In The Hospital Mao Hamasaki

  • hamazaki mao censoredanalslutMGMQmegamithe beautiful goddess queenMGMQ-084MGMQ084mgmq00084
    • 2021-11-28
    20 min

    FC2PPV 2470135 [Yui’s Weekday] Put On A Remote Control And Go To School, Spend The Day As It Is, And Diverge In The Toilet After School

  • amateur uncensoredfc2
    • 2021-12-09
    174 min

    [DANDY-790]At A Mixed Bathing Hot Springs We Thought Was Secluded, A Beautiful Lewd Woman Who Enjoys Men And Women Gets Couples To Have Non-stop Adulterous Threesomes.

  • censoredlesbianDANDYdandybacon tanakaDANDY-790DANDY7901dandy00790



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi