small boobs




FC2BBANFSDSSONEZAUKSJULDASDNATRPREDRBDDASDHODVSSISGVHSQTEWAAACESDPPPDMILKEBODSDAB

2020-12-02
131 min

[ARM-928]Girls Cum By Rubbing Their Pussies On Men's Body Parts

  • nanako miyamura sakura miyuki censoredARMaroma planninghamu oujiaromaARM-928ARM928arm00928
    • 2020-12-03
    242 min

    [SHIC-177]My StepK*d 4-Hour Collection 4

  • censoredbeautiful girlSHICshishunki.comSHIC-177SHIC177
    • 2020-12-04
    481 min

    [YMDD-216]Melody Hina Marks The Best Complete Archive: A One In 2.7 Million Beauty From Northern Europe!!!

  • melody marks censoredcreampiesingle workYMDDmomotarou eizou shuppanishikiribashi hakasejaku momoYMDD-216YMDD216ymdd00216
    • 2020-12-13
    126 min

    [HNM-010]Aya... As A Sole Submissive Girl The Girl Who Wanted To Give Up Complete Control Aya Shiomi

  • aya shiomi censoredbdsmsingle workHNMavs collector susubashisuiblack mariaHNM-010HNM010hnm00010
    • 2020-12-17
    51 min

    Pacopacomama 121720_399 Seira Oguro, Miki Horiguchi, Rinka Aisaki

  • seira oguro miki horiguchi uncensoredbig titsblowjobpacopacomama
    • 2020-12-22
    141 min

    [STARS-310]Brilliant, Beautiful Girl Loves To Cum On Huge Cocks! Her Orgasmic Limit - Endless Climaxes From Hard Pounding Nanase Asahina

  • asahina nanase censoredbeautiful girldeepthroatSTARSsod createkaorusod starSTARS-310STARS3101stars00310
    • 2020-12-27
    95 min

    [VENU-991]My Wife's Older Sister Suddenly Came On To Me And Wouldn't Let Me Stop Cumming For 1 Night And 2 Days: Rin Azuma

  • dongguan censoredcreampiemature womanVENUvenusmajime kitanofakecest winntersVENU-991VENU991venu00991
    • 2020-12-31
    486 min

    [GOMU-026]For Discerning Adult Tastes: Center Village. Jul-Dec 2020 BEST Collection 8 Hours, 2 Discs, 112 Titles, All Loads Blown, Complete Compilation!

  • censoredcreampiemature womanGOMUcenter villageGOMU-026GOMU026h-086gomu00026
    • 2020-12-31
    117 min

    [JUL-422]Brains And Beauty And Lust - Madonna Exclusive Part Two! Ready For A Creampie! Overcome With Naughty Motherly Love, Ready For Sweaty Creampie Sex With Her Stepson. Mayuka Kitagawa

  • mayuka kitagawa censoredcreampiemature womanJULmadonnamametaro mamezawaJUL-422JUL422jul00422
    • 2021-01-09
    118 min

    [DASD-796]Thanks For The Family Fuck. Finally Meeting The Girl Of The Chick I Knocked Up Decades Ago. Ten Hasumi Miho Tono

  • hasumiten miho tsuno censoredcreampiebeautiful girlDASDdaschinpo dazaiDASD-796DASD796dasd00796
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-17
    237 min

    [SORA-290]*Super Rare Extreme Freaks *Exhibitionist S********ls Broadcasting Live! Shocking Horny Teens' Vibrator Masturbation! Will They Go All The Way With A Real Creampie？!

  • censoredschoolgirlSORAyama to soratelephone poleSORA-290SORA290sora00290
    • 2021-01-18
    27 min

    FC2PPV 1649150 [4K] ≪Complete appearance≫ Intensely cute whitening & beautiful busty girl (20) ❤ Finger piston pussy dochudchu ~ While saying embarrassing, I’m excited to see it for the first time! Intrinsic lewdness that will stop and cum!

  • amateur uncensoredfc2
    • 2021-01-23
    62 min

    1Pondo 012321_001 Braless Neighbor In The Morning: Sakiko Mihara

  • amateur uncensored1pondo
    • 2021-01-27
    44 min

    FC2PPV 1661802 [No] A tall beautiful woman with good looks. Creampie after intimidating and committing and enjoying the raw vagina

  • amateur uncensoredfc2
    • 2021-01-30

    FC2PPV 1665247 [Uncensored / Individual shooting] ❤️ God-style Miss Menes ❤️ H cup ❤️ Reverse massage causes flooding of dicks. .. .. [* Immediate deletion of body baldness]

  • amateur uncensoredfc2
    • 2021-02-01
    55 min

    [PYU-128]夜●いをしたくなるほど可愛らしい女の子を欲望のままに寝込みを襲って犯しちゃいましたぁ～！ 宮沢ゆかり

  • yukari miyazawa censoredPYUcome camPYU-128PYU128h-1462pyu00128
    • 2021-02-14
    129 min

    [ARM-952]She Calls Herself A Seductress, So Why Is She Getting Turned On When She's Trying To Tempt Me？

  • kanae lennon naoko akase censoredblowjoblingerieARMaroma planninghamu oujiaromaARM-952ARM952arm00952
    • 2021-02-18
    43 min

    [oretd-846]逢見さん

  • amateur censoredcreampieuniformoretdoretd-846oretd846oretd-846
    • 2021-02-22
    36 min

    FC2PPV 1697756 [No] ♯ Fair-skinned ex-girlfriend on a slope. I cooked a vaginal cum shot of ex-girlfriend with flirting on the bed.

  • amateur uncensoredfc2
    • 2021-02-24
    179 min

    FC2PPV 1699100 049 [Facial cumshot from cum] That super popular sexy actress made a crispy beauty drink a lot of sperm and made her face dirty

  • amateur uncensoredfc2
    • 2021-03-01
    120 min

    [NACR-400]A 40-something Wife Awakens - Yu Miyajima

  • yu miyajima censoredmature womanslutNACRplanetshichidomeNACR-400NACR400h-237nacr00400
    • 2021-03-05
    150 min

    [HODV-21554]X Days With The Tall Maid And Mischievous Pervert Amu Hanamiya

  • hanamiya amu censoredcreampiebig titsHODVh m pHODV-21554HODV215545642hodv21554
    • 2021-03-16
    61 min

    Caribbeancom 031621-001 I’ma get wet!! Rei Kitajima

  • rei kitajima uncensoredcreampiehandjobcaribbeancom
    • 2021-03-18
    120 min

    [SSIS-017]You Woke Up After A Wild Party With The Hot J-Cup Boss You've Always Wanted. The Two Of You Have Your Own Afterparty - Naked - Together Mei Washio

  • mei washio censoredbig titssingle workSSISs1 no 1 stylerokusaburo mishimaSSIS-017SSIS017ssis00017
    • 2021-03-21
    117 min

    [JUL-515]I'm A New Dad And I Was Seduced By A Breastfeeding Mother In The Nursing Room Hinami Narusawa

  • hinami narusawa censoredmature womansingle workJULmadonnahiroyuki kimuraJUL-515JUL515jul00515
    • 2021-04-13
    40 min

    C0930 ki210413 Junko Ishibashi 21years old

  • amateur uncensoredc0930
    • 2021-04-18
    260 min

    [APAE-068]Getting Off For 260 Minutes On Nene Tanaka!

  • nene tanaka censoredcreampiebig titsAPAEaurora project annexh nasuyukiaurora project exAPAE-068APAE068apae00068
    • 2021-04-22
    206 min

    [SVDVD-854]Shame The New Female Teacher Will Be Our Sketch Model For Pornography Class! In Order To Help Her S*****ts Who Are Applying To Art Colleges, She'll Put Her Pussy To Good Use And Let Them Fuck Her With Their Big Cocks!! An Extracurricul

  • rui minagawa himesaki hana censoredcreampiebig titsSVDVDsadistic villageista girl and her shameSVDVD-854SVDVD8541svdvd00854
    • 2021-04-24
    34 min

    FC2PPV 1784966 [Individual shooting 36] Prefectural K ③ Active model Shaved ⑰ After midnight exposure wandering, vaginal cum shot in the men’s toilet

  • amateur uncensoredfc2
    • 2021-04-26
    39 min

    FC2PPV 1787250 [Complete appearance Hana-chan return work] Welcome back Hana-chan! Suddenly after returning, the first intercrural sex & vaginal cum shot H in my life! Even after vaginal cum shot, sperm is licked with a smile

  • amateur uncensoredfc2
    • 2021-04-30
    48 min

    FC2PPV 1794381 Limited to 700 yen x 100! 4 barrage of 5P vaginal cum shot! !! Gentle on a simple girl and carve the pleasures of sex on her body ♪ Pure 19-year-old Sumire who does not even treat waste hair (armpit hair, pubic hair) because she does n

  • amateur uncensoredfc2
    • 2021-05-21
    154 min

    [CAWD-222]I'm A Loser Who Can't Do Anything Right At My Job, And My Big Tits Female Colleague Likes To Make Fun Of Me, But Suddenly, To Our Surprise, We Were Booked Into The Same Hotel Room ... I'm A Cherry Boy, But I Went With The Flow A

  • emi fukada himesaki hana censoredcreampiebig titsCAWDkawaiiamazing meatCAWD-222CAWD222cawd00222
    • 2021-06-04
    120 min

    [SSIS-084](*Abnormally Massive Ecstasy) The Greatest Erotic Awakening Ever! Furious Non-Stop Serious Sex That Won't Stop Until They Burn Off All Of Their Lust Aka Asuka

  • arisu aka censoredbig titssingle workSSISs1 no 1 styleichigoharaSSIS-084SSIS084ssis00084
    • 2021-06-05
    121 min

    [SCD-194]Emi Toda Is A MILF Celebrating Her 60th Birthday By Giving Me An Erection Capsule

  • emi toda censoredmature womanslutSCDrubyscoopSCD-194SCD194scd00194
    • 2021-06-08
    57 min

    HEYZO 2544 Flat-chested Girl In School Uniform Gets Multiple Cream Pies – Amu Mashiro

  • amu mashiro uncensoredcreampiehandjobheyzo
    • 2021-07-03
    141 min

    [PKPD-154]Creampie Debut Document: Tall SSS Style Insurance Lady - Yuno Kamikari

  • yuno kamikari censoredcreampiesingle workPKPDfuck group and fun friends daydreamersPKPD-154PKPD154pkpd00154
    • 2021-07-09
    150 min

    [IPIT-019]A Healing Beauty Who Is a Top Pick at a Members-Only Lounge Where Ordinary People Are Not Allowed: A Mountaintop Flower Beyond Our Reach. Hitomi Hoshitani's AV Debut

  • hitomi hoshitani censoredblowjobsingle workIPITidea pocketmichiru arashiyamaideapocket talent discovery projectIPIT-019IPIT019ipit00019
    • 2021-07-14
    68 min

    510ELLO-013 Concafe Nampa Rin chan

  • amateur censoredamateurelloello-013ello013510ello-013
    • 2021-07-20
    77 min

    [KIR-039]My College S********l Sister Was Fucked To Pay Off My Loans Misa Amagami

  • misa tenjo censoredcreampiesisterKIRstar paradisekirei star paradiseKIR-039KIR039h-254kir00039
    • 2021-08-05
    118 min

    [LOL-198]The Day I Became A Pervert-Rin Miyazaki

  • miyazaki rin censoredcreampiebeautiful girlLOLglayzrori senkaLOL-198LOL19812lol00198
    • 2021-08-13
    45 min

    480FRIN-045 "Personal Shooting" P Adult Scene Voyeur Of A Beautiful Female College Student. Sweaty Middle-Aged Ji ● Nasty Big Butt Who Devours Po Continuously Cum Straddling Raw Sex

  • amateur censoredcreampieamateurfrinfrin-045frin045480frin-045
    • 2021-08-13
    118 min

    [SSIS-156]I"m A Teacher, And My Big Tits S*****t Is Not Wearing Her Bra And Luring Me To Temptation, And I Lost My Mind, And Ejaculated In Her, Over And Over Again. Uta Hayano

  • hayano uta censoredbig titsuniformSSISs1 no 1 stylemamezawa mametarouSSIS-156SSIS156ssis00156
    • 2021-09-07
    129 min

    [KTRA-327]Enticing Sex Every Day With My Younger Stepsister, Who Has A Brother Complex And Is Good At Being Spoiled, Aya Mamiya

  • aya mamiya censoredcreampieuniformKTRAke toraibuk tribeKTRA-327KTRA327h-094ktra00327
    • 2021-09-18
    128 min

    [MKON-062]My C***dhood Friend Is About To Have Sex With My Male Friend. And I"m In Charge Of Filming It. Yui Nagase

  • yui nagase censoredcreampieslutMKONkaguya hime pt mousozokuyumesaki ichiroumikonMKON-062MKON062mkon00062
    • 2021-10-01
    34 min

    FC2PPV 2281430 [No] [Limited To 100 Pieces 2980 → Off To 1480pt!] Excited To Be Seen By People! Metamorphosis Beauty ♥ ️ Even Though I Have A First-Class Secretary Test … Lol, ♥ ️ Massive Vaginal Cum Shot! !! ♥ ️ * Review Benefits / High Image Q

  • amateur uncensoredfc2
    • 2021-10-01
    129 min

    [CAWD-287]Crazy Fuck Dripping In Sweat, Squirting, And Love Juice With Horny Stepdaughter, Yui Amane

  • amane yui censoredcreampiesingle workCAWDkawaiiasagiri jouCAWD-287CAWD287cawd00287
    • 2021-10-07
    161 min

    [SUN-032]Contraceptive Cum D***king An Intellectual Art College S*****t Who Goes Outdoors To D***k Condoms Filled With Cum

  • amemiya kotone censoredbig titssingle workSUNsuntanaka baconSUN-032SUN03213sun00032
    • 2021-10-13
    88 min

    435MFC-149 [Nomination Of Raw Squirrel With Black Hair Absolute Beautiful Girl] Pure Girl With Super Beautiful Cool Beauty Appearance! ？？ I Will Have A Fledgling Shaved Hostess Before Going To Work ♪ Hair Job, Foot Job, Electric Massage Machine, Vagi

  • amateur censoredcreampieamateurmfcmfc-149mfc149435mfc-149
    • 2021-10-22
    39 min

    FC2PPV 2364568 [Personal Shooting, Orgy, Vaginal Cum Shot, 500p Off For A Limited Time] A Delicate Wife Who Keeps Aching And Prioritizes The Insertion Of Other Sticks Over The House.

  • amateur uncensoredfc2
    • 2021-11-19
    251 min

    [DVDMS-741]Married Former Idol Is A Pervert Who Likes To Have Her Hairy Pussy And Anus Licked, And Cums Like Crazy While Having Watersports Sex Starring Mayu Suzuki

  • suzuki mayu censoredcreampieslutDVDMSpero motofujiflavorsDVDMS-741DVDMS741dvdms00741
    • 2021-11-26
    121 min

    [EKW-075]A Woman Lasciviously Watching From The Sidelines, Rinne And Touka

  • roaring sound censoredbig titsblowjobEKWwaap entertainmentk westcobra warpEKW-075EKW0752ekw00075
    • 2021-12-09
    158 min

    [SPRD-1495]After The Class Reunion... Honoka Tsuji

  • tsujii honoka censoredmature womansingle workSPRDtakara eizoutakara hiroshialeddinSPRD-1495SPRD149518sprd01495
    • 2021-12-09
    67 min

    SIRO-4666 [First Shot] [Obvious Tongue Tech] [Soft Beautiful Breasts] A Shy Cookie Shop Clerk Appears. Shy But Reluctantly Entwined With A Man, Repeatedly Cumming On The Gradually Accelerating Advance Of The Penis .. Application Amateur, First AV Sho

  • amateur censoredamateursirosiro-4666siro4666siro-4666
    • 2021-12-10
    62 min

    328HMDN-434 Mana (Aina Shinkawa)

  • amateur censoredcreampiebig titshmdnhmdn-434hmdn434328hmdn-434
    • 2021-12-16
    63 min

    336KNB-185 [This Is Real Married Woman Boobs! ] Good-Looking Wife Saddle Only Www Personality Is Good ● Po Lover, There Is No Loss To A Married Woman With A Fluffy Body Wwww At Kemigawa Station Square, Hanamigawa-Ku, Chiba City, Chiba Prefecture (Nan

  • amateur censoredbig titsmarried womanknbknb-185knb185336knb-185



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi