taken down




FC2STARSATIDMVSDNNPJWANZHMNJULSPRDCAWDHDKAPREDGMEMHNDGVHNATRNACRMIDVABWVEMAAVSA

2020-11-19
150 min

[MADM-134]Married Woman G*******g - Happy Housewife Gets Ravished While Her Husband's Away

  • satomi suzuki anne mashiro censoredcreampiebig titsMADMcrystal eizoharuo miyafujimadam maniacMADM-134MADM13449madm00134
    • 2020-11-20
    192 min

    [DOCP-258]"Shhh! You Can't Make A Sound... We Need To Keep This A Secret From My Big Sister While We Fuck..." My Wife's Young Sister Seduced Me, And I Tried To Refuse Her Advances By Telling Her, "We Can't Do This!" But

  • is it ran shion censoredcreampiebig titsDOCPprestigedoc premiumDOCP-258DOCP258118docp00258
    • 2020-11-27
    76 min

    483HMHI-609 Nonoka 2

  • amateur censoredbig titsamateurhmhihmhi-609hmhi609hmhi-609
    • 2020-11-29
    266 min

    [GAV-055]The Boobs Of A Girl So Beautiful She's A National Treasure vol. 3

  • censoredcreampiebig titsGAVgogo adult videosGAV-055GAV055gav00055
    • 2020-12-01
    120 min

    [C-2595]Day Trip Spa Mature Woman Lust Trip #015

  • censoredmature womanCgogoskoichi takahashigogo s coreC-2595C2595140c02595
    • 2020-12-04
    127 min

    [SGA-146]The Finest Lover, The Finest Creampie Sex. 60 - Slender Gorgeous Girl Wants A Creampie Rara

  • censoredcreampieamateurSGAprestigesetsugetsukaSGA-146SGA146118sga00146
    • 2020-12-12
    50 min

    [tkwa-141]あい

  • amateur censoreduniformschoolgirltkwatkwa-141tkwa141tkwa-141
    • 2020-12-20
    158 min

    [MISM-191]Consultant Trainee Gets Her Asshole Stretched Wide Open Too Much So That It Won't Close

  • censoredanalMISMm girls labinaballMISM-191MISM191mism00191
    • 2020-12-27
    240 min

    [MCSO-006]The Best Big Asses! Cumming While Being Piston Fucked Hard As Her Asshole Twitches

  • censoredMCSOmercurypremier dreamMCSO-006MCSO006h-1133mcso00006
    • 2020-12-27
    239 min

    [RDVHJ-126]Ultimate! Picking Up Amateur Housewives 2! Married Women Picked Up & Made To Cum Like Mad As They Get Their G-Spots Fiddled And Then Given A Creampie Fuck - 4 Hours

  • censoredcreampiesquirtingRDVHJgraffiti japanfairestRDVHJ-126RDVHJ12648rdvhj00126
    • 2020-12-29
    130 min

    [SDAB-160]Hotel G*******g With A Beautiful Y********l In Uniform - She Should Have Been Practicing Her Dance For The Town Festival But Ended Up Getting Nailed By Four Older Guys All Night Long Marina Saito

  • marina saito censoredsingle workSDABsod createkomatsu 17one s youthSDAB-160SDAB1601sdab00160
    • 2021-01-09
    169 min

    [JUFE-248]I Ordered A Delivery Heath Call Girl Who Didn't Allow Real Fucking, And My Plain Jane And Shy Colleague From The Business Affairs Department Came Over... Starting Today, I'm Going To Make This Bitch My Raw Big Tits Sex Toy Rina Asuk

  • asuka riina censoredcreampiebig titsJUFEfitchJUFE-248JUFE248jufe00248
    • 2021-01-10
    57 min

    HEYZO 2433 Amateur Perv Girl Wanna Be Played With – Rikako Yamada

  • rikako yamada uncensoredcreampieheyzo
    • 2021-01-23
    149 min

    [HND-943]This Pay-For-Play Gal Is Usually A Cold Fish During Sex, But When She Won The Lottery She Immediately Changed Her Tune! This Slut Kept On Begging For Creampie Sex While Earning Tips. Hina Nanami

  • hina nanami hina nanase censoredcreampieblowjobHNDhon nakausa pyonHND-943HND943hnd00943
    • 2021-02-05
    42 min

    [ZOZO-051]Akari Shiina

  • censoredZOZOsadie willenauZOZO-051ZOZO0511zozo00051
    • 2021-02-05
    240 min

    [HODV-21552]Best Of Mizuki Yayoi

  • mizuki yayoi censoredcreampiebeautiful girlHODVh m pHODV-21552HODV215525642hodv21552
    • 2021-02-06
    180 min

    [HUNTA-939]They'll Fuck Anyone For A Fixed Fee! If You Pay A Monthly Subion, You Can Fuck Any Of The Female Stuff At This Hospital! Creampie Sex Included! Why Not Try Becoming A Patient...

  • censoredcreampieblowjobHUNTAhunterkorosukehhh groupHUNTA-939HUNTA939hunta00939
    • 2021-02-06
    56 min

    H0930 ki210207 Misa Oohara 45years old

  • amateur uncensoredh0930
    • 2021-02-11
    65 min

    FC2PPV 1680935 [No] ♀ 297 Female college student Miyabi-chan, 18 years old, 1st time Dirty back dirt offer to conceive from girls! Dangerous day Ma ◯ Ko is seeded and vaginal cum shot makes her a mom! (LOL)

  • amateur uncensoredfc2
    • 2021-02-13
    39 min

    H4610 ki210214 Moe Serizawa 18years old

  • amateur uncensoredh4610
    • 2021-02-15
    233 min

    [PYM-365]Self Shots - Limitless Orgasms - Pleasured Pussy Spread Wide For Masturbation

  • censoredPYMprimoPYM-365PYM365h-283pym00365
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-25
    64 min

    [orec-704]とうか

  • amateur censoredcreampiebig titsorecorec-704orec704orec-704
    • 2021-03-05
    58 min

    383REIW-037 Uruka

  • amateur censoredcreampiebig titsreiwreiw-037reiw037383reiw-037
    • 2021-03-06
    234 min

    [HUNTA-962]"I Want You To Defile My Wife" I Went Away On Business On Purpose So That My Wife Could Get Breaking In Training From Another Man, And As I Was Peeping On Her, She Showed Me Facial Orgasmic Expressions That She Would Never Show To

  • censoredHUNTAhunterkawajirihhh groupHUNTA-962HUNTA962hunta00962
    • 2021-03-06
    132 min

    [BBAN-314]Lesbian Gray: What Earns More？ Cash Or A Woman's Body...

  • satoshi kuruki misono waka censoredlesbianbeautiful girlBBANbibianBBAN-314BBAN314bban00314
    • 2021-03-12
    123 min

    [SABA-680]Totally POV Your Favorite Colleague Is Excessively Horny, So You Skipped Work And Kept On Fucking Her It's Her 2nd Year On The Job Tojo-san 24 Years Old

  • censoredcreampieuniformSABAskyu shirototodoSABA-680SABA680h-244saba00680
    • 2021-03-18
    147 min

    [MVSD-458]High Class Married Woman Becomes A Streetcorner Slut - I Can't Believe I Got To See Her Like This, Let Alone Make My Stepmom Cum

  • censoredcreampiebig titsMVSDm s video groupbungo maedaMVSD-458MVSD458mvsd00458
    • 2021-03-22
    102 min

    241GAREA-500 Airu

  • amateur censoredamateurnursegareagarea-500garea500241garea-500
    • 2021-03-26
    70 min

    230OREX-205 Luna-chan

  • amateur censoredcreampieuniformorexorex-205orex205230orex-205
    • 2021-04-17
    55 min

    [c0930-tk0032]衣川 彩恵 28歳

  • amateur uncensoredc0930
    • 2021-04-24
    30 min

    492JCHA-021 I want a woman to talk to me 3

  • amateur censoredschoolgirlamateurjchajcha-021jcha021492jcha-021
    • 2021-04-27
    43 min

    490FAN-052 Kana

  • amateur censoredcreampieamateurfanfan-052fan052490fan-052
    • 2021-05-03
    64 min

    FC2PPV 1799870 [3P orgy / pleasure training] My boyfriend told me … A girl who doesn’t know anything dedicates her undeveloped body to pleasure training for her boyfriend. Creampie sex to demon squid

  • amateur uncensoredfc2
    • 2021-05-20
    77 min

    [VNDS-3366]Taking Flirty Business Woman Home

  • censoreduniformVNDSstar paradisenext toilet r eVNDS-3366VNDS3366h-254vnds03366
    • 2021-06-17
    60 min

    10musume 061721_01 Anal Creampie : Have a twitched in my ass

  • amateur uncensored10musume
    • 2021-07-14
    81 min

    259LUXU-1436 Luxury Tv 1430 "i Want To Have Rich Sex …" A Beautiful President Who Has Over 10 Years Of Work Without A Boyfriend Appears For The First Time! !! The Warmth And Stimulation Of The Man Who Was About To Forget … Shake The

  • amateur censoredamateurluxuluxu-1436luxu1436259luxu-1436
    • 2021-07-17
    62 min

    FC2PPV 1926505 [Advent Of The Stakeout Goddess] Innocent Jd Miriya-Chan (20 Years Old) Go To Heaven ♡

  • amateur uncensoredfc2
    • 2021-07-18
    69 min

    SIRO-4562 [First Shot] [Pounding Window Standing Back] [Slut Service Of Carnivorous Gal] Carnivorous Gal Who Is Hungry For Naughty Things After Breaking Up With Her Boyfriend. While Shaking F Milk And Cumming Many Times, If You Turn To Blame Yourself

  • amateur censoredbig titssquirtingsirosiro-4562siro4562siro-4562
    • 2021-08-17
    190 min

    [SDNM-296]A Pregnant-like Belly Is The MILF"s Proof, Rui Akina, 30 Years Old, AV DEBUT

  • akina rui censoredmarried womansoloworkSDNMsod createkaoruhonmono hitodzuma dannani naisho de av taikenSDNM-296SDNM296
    • 2021-08-20
    51 min

    FC2PPV 2052614 * Weekend Limited 6000⇒3980 ★ First Shot ☆ Miraculous Thirty Beauty ♥ Former Race Queen ♥ Gokubi Body Towako 32 Years Old ♥ Exciting! Continuous Iki ♥ De M Irama’S Drooling Lust ♥ Excited Mass Cum Shot ♥ * 2 Consecutive Blowjobs W

  • amateur uncensoredfc2
    • 2021-09-09

    FC2PPV 2179147 When I Let A Junior Yakara Ntr A Girl Who Felt Good With Me In Front Of Me, I Got The First Middle-Aged Girl In My Life. I Cannot Contact You After That.

  • amateur uncensoredfc2
    • 2021-09-11
    240 min

    [NASH-565]She Turned Out To Be Just My Type Alone In The Bath With My Mother... These Hot Mamas Didn"t Take Their K*ds Seriously And Exposed Their Naked Bodies To Their Ecstatic Cocks I Made The Mistake Of Fucking My Mother And Now You Get To See

  • kohinata mai yukie mizukami censoredmature womanNASHpinkjun nagasawanadeshikoNASH-565NASH565nash00565
    • 2021-09-11
    61 min

    519MAZOF-015 [Gold Comes Out From The Hole In The Pussy! ] Bank Clerk 24 Years Old ♀ [Training Pickled] If You Call During A Break And Limbs, The Pussy Will Get Soaked! If You Hit The Ass And Pierce The Uterus, The Demon Acme → I’m Sorry! I̵

  • amateur censoredcreampiebig titsmazofmazof-015mazof015519mazof-015
    • 2021-09-17
    30 min

    FC2PPV 2212749 * Super Deals Limited To Consecutive Holidays 980 Yen! * 19-Year-Old [Shimbashi_hospital Receptionist] Cosplay Student Support 〇

  • amateur uncensoredfc2
    • 2021-10-02
    150 min

    [XVSR-614]She"s Getting 14 Cum Shots Of Creamy Sperm In 24 Hours A Massage Parlor Therapist Experiences An Orgasmic Downfall In Confinement - Endless Impregnation - Mami Nagase

  • asami nagase censoredcreampiebig titsXVSRmax ayoshida ikuzocalenXVSR-614XVSR614xvsr00614
    • 2021-10-15
    62 min

    SIRO-4664 [First Shot] [Beautiful Skin Full Of Transparency] [Pretty Beautiful Girl] Discovered An Active JD With A Beautiful Face That Is As Good As An Idol. The Young And Beautiful Body, Which Has Few Encounters And Frustration, Flushes The White S

  • amateur censoredamateursirosiro-4664siro4664siro-4664
    • 2021-10-29
    181 min

    [MTES-062]Something That Often Happens: A Stepfather Who Goes After His Stepdaughter

  • censoredbig titsmature womanMTEShenry tsukamotomeisaku pornoMTES-062MTES062h-1300mtes00062
    • 2021-11-19
    151 min

    [SSIS-243]Aika Yumeno Will Stimulate Your Five Senses With Luxurious Nookie Support That Will Blow Your Mind And Satisfy All Of Your Erotic Desires In These 5 Soothing And Extremely Ejaculatory Erection Situations

  • yumeno aika censoredsingle workSSISs1 no 1 stylemasaki naoSSIS-243SSIS243ssis00243
    • 2021-11-19
    119 min

    [HMN-076]Um!! College Girl with an Idol"s Faith Suddenly Transfers and Immediately Has Her First Unprotected Creampie. Meisa Kawakita

  • kawakita meisa censoredcreampiebeautiful girlHMNhonnakataiga kosakaiHMN-076HMN076hmn00076
    • 2021-12-04
    119 min

    [AUKG-527]The Married Woman And That Girl. Married Woman Hostess And Lesbian Soap Girl Yuri Honma Sumire Tanba

  • really niwa sumire censoredbig titslesbianAUKGu krentoAUKG-527AUKG527aukg00527
    • 2021-12-18
    106 min

    [DDHZ-014]Medicated Brain Bug Cuckholding In Front Of Husband Kitano Yuna

  • yuna kitano censoredcreampiedeepthroatDDHZdogmanormal kimmy wifeDDHZ-014DDHZ014ddhz00014
    • 2021-12-18
    55 min

    FC2PPV 2526442 J ○ I Met In The App Looks Sober, But … It Was Very Naughty With Big Ass Big Milk. If You Stir A Perverted Pussy With A Cock, You Will Cum!

  • amateur uncensoredfc2
    • 2022-01-14
    123 min

    [BOBB-330]Exquisite I-Cup Titties x Big Tits Boin Momo Minami Boxed Set Fondle, Lick, Slurp, And Jiggle And Wiggle Those Titties To Your Full Satisfaction In A Full Course Of Titties! You Won"t Want To Miss This Epic Of Wraparound Titties In A Fu

  • minami peach censoredbig titssingle workBOBBabc mousouzokuboinbb abcBOBB-330BOBB330bobb00330
    • 2022-01-21
    56 min

    FC2PPV 2609444 [No] Modest Slender Girl Who Is Weak To Push ♡ "I’ll Put It In My Mouth" "Yeah ♡" "I Can Insert It Raw" "Yeah ♡" The Last Is Unauthorized Vaginal Cum Shot Ww Mouth + Two Ejaculations During Life

  • amateur uncensoredfc2
    • 2022-02-04
    165 min

    [HODV-21650]Married Woman REC This Married Woman Moved In To My Apartment Building, And She Dresses Like A Slut, Which Is Just How I Like It, And Every Day, I Stole Peeks At Her, Until One Day, She Totally Caught Me In The Act ... "Hey You ... Yo

  • censoredcreampiebig titsHODVh m pHODV-21650HODV216505642hodv21650



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi