• Log in

  • Sign up
JavKiwi
  • Home
  • Jav Uncensored
  • Jav Censored
  • New Releases
  • Trending
  • actors
  • Tags
  • Random Videos
  • Upload your videos
    • Log in
    • Sign up
  • Home
  • Jav Uncensored
  • Jav Censored
  • New Releases
  • Trending
  • Random
  • amateur

  • anal

  • bdsm

  • big tits

  • blowjob

  • bukkake

  • cosplay

  • creampie

  • cumshot

  • deepthroat

  • handjob

  • hardcore

  • japan

  • lesbian

  • lingerie

  • maid

  • married woman

  • massage

  • milf

  • nurse

  • office

  • outdoor

  • school

  • schoolgirl

  • single work

  • squirt

  • teacher

  • teen

  • uniform

chihaya maria




FC2IPXKSBJLULUNATRHNDAVSADASDSHKDAWDMIDEJUFEMARAHDKAVEMASSNINACRCHRVPREDMVSDKBI

2024-02-16
150 min

EBWH-072 My Brother"s Wife"s Physical Beauty Is Too Attractive... Aphrodisiac Is Mixed With Protein And A Strong Woman"s Body Is Confirmed To Be Pregnant, Creampie Sex Maria Chihaya

  • chihaya maria censoredcreampiebig titsEBWHe bodytrendy yamaguchiEBWH-072EBWH072ebwh00072
  • 2024-01-12
    170 min

    EBWH-065 I Can"t Tell You The Name Of The Store, But A Popular Trainer Who Works At A Personal Gym In Kansai. Beautiful Body And Big Breasts Coexisting Body VS Macho Actor. Athlete"s Flesh-and-blood Sex. AV Debut. Maria Chihaya.

  • chihaya maria censoredsingle workEBWHe bodycrestEBWH-065EBWH065ebwh00065
  • 1



  • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi
    • Legal

    • 18 U.S.C. 2257
    • Contact Us
    • DMCA
    • Useful

    • Sign up
    • Log in
    • FAQ
    • Contact
    • Friends

    • Girls Do Porn
    • GirlsDoPorn
    • DaftSex
    • TayLee Wood
    • WoodmanCastingX
    •